DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and dati

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001245421.1 Gene:dati / 43789 FlyBaseID:FBgn0262636 Length:1150 Species:Drosophila melanogaster


Alignment Length:468 Identity:109/468 - (23%)
Similarity:184/468 - (39%) Gaps:110/468 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EQPPL--YHSLYD--ASSQLAVELKALAPALRL------------EHGDNLTDVICDLCLRRLHD 66
            :.|.|  :|.|::  |::..||.||:.|....|            .:|....:.:|.:..::..|
  Fly   162 QSPQLSSHHLLFNAAAAAAAAVHLKSTAMQNNLSPIGDQVQNNLRNYGQGSLNALCGIKPKQEMD 226

  Fly    67 ARDFQR---RCEHSEQVLRMRHEHWKHTVAVGDALALDDVLECLEREVGSLEGPMSVPLQASKPV 128
            |:...:   .|.|.....:.:.::.      ||..   ||.:...||:.  ||...:       :
  Fly   227 AKTPLQPLDECPHPLVQAQAQSQYG------GDYY---DVADPQAREIS--EGRALI-------I 273

  Fly   129 AHVAPLMETVDFESLDFQDSSHSE-----------HDIPSYWESSVDSGSLNTPHHQ-PETAELF 181
            ...||...:.|    |.|.|:.|.           |........:|.|.:|...... |.|....
  Fly   274 GLGAPSTVSTD----DAQSSAPSHQLAGTGRALQTHQCKPMSPGTVGSSNLGAGRRSAPTTISKT 334

  Fly   182 AVEPPTPPESSEEPAPDAAEKPKMRRARPRQDN---VKPKERKASGAVHPRSLHPCPECEKKFTR 243
            ..:....|:.|..|: ..:..|.::....:..|   ::.....::.|:..|:|.   ||.....|
  Fly   335 FSQGQQSPQHSTTPS-GGSTTPDIKYNNDKMANEIQLQLSRSSSAAAISERTLE---ECWSTLQR 395

  Fly   244 NFQLKLHMTAV-----------HGM-------GEMR-------YQCEECRKNFASRHSLRYHVKS 283
            .|..|..|..:           ||:       |.:.       :||::|.|:|:|.|.|..|:: 
  Fly   396 LFMHKSAMQQIQQQIPRVGLGTHGVTGSANLGGSITPSSDTKPHQCQQCMKSFSSNHQLVQHIR- 459

  Fly   284 VHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQ--RCSKSWPTKSDLRTHMRSHNP 346
            ||:.|:|:.|.:|||||...:.:..|.|.||||   |.::|.  .|.:::...|:|:.|:|:|:.
  Fly   460 VHTGEKPYKCSYCDRRFKQLSHVQQHTRLHTGE---RPYKCHLPDCGRAFIQLSNLQQHLRNHDA 521

  Fly   347 NME----RPFKCDRCSKAFFTRGHLNSH----LLVHT-----------GEKPFACEYCDKCYQSV 392
            .:|    |||.|:.|.|.|.|...|.:|    |.:|.           |....:|..|.|.:...
  Fly   522 QVERAKNRPFHCNICGKGFATESSLRTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGT 586

  Fly   393 GNLNNHMVRLHAD 405
            ..|.:||..:|.:
  Fly   587 EALVDHMKHVHKE 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 17/82 (21%)
C2H2 Zn finger 234..255 CDD:275368 6/31 (19%)
C2H2 Zn finger 264..285 CDD:275368 8/20 (40%)
C2H2 Zn finger 293..313 CDD:275368 8/19 (42%)
zf-C2H2_8 305..373 CDD:292531 26/77 (34%)
C2H2 Zn finger 324..344 CDD:275368 6/21 (29%)
C2H2 Zn finger 354..374 CDD:275368 8/23 (35%)
zf-H2C2_2 366..389 CDD:290200 8/37 (22%)
C2H2 Zn finger 382..403 CDD:275368 6/20 (30%)
datiNP_001245421.1 COG5048 <429..>511 CDD:227381 28/85 (33%)
C2H2 Zn finger 441..461 CDD:275368 8/20 (40%)
zf-H2C2_2 454..478 CDD:290200 12/24 (50%)
C2H2 Zn finger 469..489 CDD:275368 8/19 (42%)
zf-H2C2_2 481..508 CDD:290200 9/29 (31%)
C2H2 Zn finger 497..519 CDD:275368 6/21 (29%)
C2H2 Zn finger 533..557 CDD:275368 8/23 (35%)
C2H2 Zn finger 576..594 CDD:275368 5/17 (29%)
C2H2 Zn finger 667..687 CDD:275370
C2H2 Zn finger 702..719 CDD:275370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.