DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and Sry-delta

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster


Alignment Length:351 Identity:70/351 - (19%)
Similarity:127/351 - (36%) Gaps:64/351 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 ALALDDVLECLEREVGSLEGPMSVPLQASKPVAHVAP--LMETVDFESLDFQDSSHSEHDIPSYW 159
            :|.|..:..|::.::.            .||.|.:.|  ..|..|:::: ..:...::..:.:..
  Fly    38 SLVLTHLANCIQTQLD------------LKPGARLCPRCFQELSDYDTI-MVNLMTTQKRLTTQL 89

  Fly   160 ESSVDSGSLNTPHHQPETAELFAVEPPTPPESSEEPAPDA------------AEKPKMRRARPRQ 212
            :     |:|.:....||:.|...||....|:|..|...||            .|:......|...
  Fly    90 K-----GALKSEFEVPESGEDILVEEVEIPQSDVETDADAEADALFVELVKDQEESDTEIKREFV 149

  Fly   213 DNVKPKE----------------------RKASGAVHP---RSLHPCPECEKKFTRNFQLKLHMT 252
            |..:.::                      :.:.|...|   |....|..|.|.:...:||:.|::
  Fly   150 DEEEEEDDDDDDEFICEDVDVGDSEALYGKSSDGEDRPTKKRVKQECTTCGKVYNSWYQLQKHIS 214

  Fly   253 AVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEA 317
            ..|.. :..:.|..|.........|..|: ::|..:....|::|.:.|......|.|:|.|..:.
  Fly   215 EEHSK-QPNHICPICGVIRRDEEYLELHM-NLHEGKTEKQCRYCPKSFSRPVNTLRHMRMHWDKK 277

  Fly   318 KPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKP-FA 381
            |   ::|::|...:...:.|..|...|... |.|..|..|:.:|.:|...|.|.|:|...:| ..
  Fly   278 K---YQCEKCGLRFSQDNLLYNHRLRHEAE-ENPIICSICNVSFKSRKTFNHHTLIHKENRPRHY 338

  Fly   382 CEYCDKCYQSVGNLNNHMVRLHADII 407
            |..|.|.:.....|..||.....|::
  Fly   339 CSVCPKSFTERYTLKMHMKTHEGDVV 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 6/20 (30%)
C2H2 Zn finger 264..285 CDD:275368 4/20 (20%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
zf-C2H2_8 305..373 CDD:292531 18/67 (27%)
C2H2 Zn finger 324..344 CDD:275368 4/19 (21%)
C2H2 Zn finger 354..374 CDD:275368 7/19 (37%)
zf-H2C2_2 366..389 CDD:290200 8/23 (35%)
C2H2 Zn finger 382..403 CDD:275368 6/20 (30%)
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 39/160 (24%)
C2H2 Zn finger 225..245 CDD:275368 4/20 (20%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
C2H2 Zn finger 281..301 CDD:275368 4/19 (21%)
C2H2 Zn finger 310..327 CDD:275370 5/16 (31%)
zf-C2H2 337..359 CDD:278523 6/21 (29%)
C2H2 Zn finger 339..359 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.