DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and gl

DIOPT Version :10

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001262708.1 Gene:gl / 42210 FlyBaseID:FBgn0004618 Length:679 Species:Drosophila melanogaster


Alignment Length:149 Identity:60/149 - (40%)
Similarity:88/149 - (59%) Gaps:8/149 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 GEMRYQ-CEECRKNFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRI 321
            |||:.. |..|.|.:|...:|:.|::: ||.|||:.|..|::.|.....|.:|:|||||: ||  
  Fly   432 GEMKPNLCRLCGKTYARPSTLKTHLRT-HSGERPYRCPDCNKSFSQAANLTAHVRTHTGQ-KP-- 492

  Fly   322 FECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCD 386
            |.|..|.:.:...|.:.||||:|:.  |||::|..|.|:|.....|..||.:|:||||:.|:.|.
  Fly   493 FRCPICDRRFSQSSSVTTHMRTHSG--ERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCL 555

  Fly   387 KCYQSVGNLNNHMVRLHAD 405
            ..:...||||.|| |:|.:
  Fly   556 LRFSQSGNLNRHM-RVHGN 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:214871
KREPA <181..>257 CDD:483960
SFP1 <233..285 CDD:227516 9/27 (33%)
C2H2 Zn finger 234..255 CDD:275368
C2H2 Zn finger 264..285 CDD:275368 6/20 (30%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 354..374 CDD:275368 7/19 (37%)
zf-H2C2_2 366..389 CDD:463886 10/22 (45%)
C2H2 Zn finger 382..403 CDD:275368 9/20 (45%)
glNP_001262708.1 COG5048 <426..571 CDD:227381 59/145 (41%)
C2H2 Zn finger 439..459 CDD:275368 6/20 (30%)
C2H2 Zn finger 467..487 CDD:275368 6/19 (32%)
C2H2 Zn finger 495..515 CDD:275368 7/19 (37%)
C2H2 Zn finger 523..543 CDD:275368 7/19 (37%)
C2H2 Zn finger 551..571 CDD:275368 9/20 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.