DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and su(Hw)

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001247098.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster


Alignment Length:385 Identity:93/385 - (24%)
Similarity:156/385 - (40%) Gaps:87/385 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LTDVICDLCLRRLHDARDFQRRCEHSEQVLRMRHEHWKHTVAVGDALALDDVLECLEREVGSLEG 116
            :.:.:|..|.:.....:..::..|.      .|::...|       |...|:|:.||:       
  Fly   217 IVEHVCGKCYKTFRRVQSLKKHLEF------CRYDSGYH-------LRKADMLKNLEK------- 261

  Fly   117 PMSVPLQASKPVAHVAPLMETVD--FESLDFQDSSHSEH----DIPSYWESSVDSGSLNTPHHQP 175
                       :...|.:||..|  |...:..|:.|..|    |.|..:::       .|.:.: 
  Fly   262 -----------IEKDAVVMEKKDICFCCSESYDTFHLGHINCPDCPKSFKT-------QTSYER- 307

  Fly   176 ETAELFAVEPPTPPESSEEPA--------PDAA----EKPKMRRARP-----------RQDNVKP 217
               .:|.    |..|.|:.|.        .:|.    |:....|.:|           |..::|.
  Fly   308 ---HIFI----THSEFSDFPCSICNANLRSEALLALHEEQHKSRGKPYACKICGKDFTRSYHLKR 365

  Fly   218 KERKASGAVHPRSLHPCPECEKKFTRNFQLKLHMTAVHG---MGEMRYQCEECRKNFASRHSLRY 279
            .::.:|.:.:......|..|::.|.|...|:.|:....|   :.:..|.|..|:..|.|..:|..
  Fly   366 HQKYSSCSSNETDTMSCKVCDRVFYRLDNLRSHLKQHLGTQVVKKPEYMCHTCKNCFYSLSTLNI 430

  Fly   280 HVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRSH 344
            |::: |:.|:||.|..||::|.....|..|.|.|||| ||  :.|..|::::..|..|..||:.|
  Fly   431 HIRT-HTGEKPFDCDLCDKKFSALVALKKHRRYHTGE-KP--YSCTVCNQAFAVKEVLNRHMKRH 491

  Fly   345 NPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMVRLHA 404
            ..  |||.|||.|.|:|.....|.:|...|.  :||.||.||:.:::...|..| |:.|:
  Fly   492 TG--ERPHKCDECGKSFIQATQLRTHSKTHI--RPFPCEQCDEKFKTEKQLERH-VKTHS 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 3/29 (10%)
C2H2 Zn finger 234..255 CDD:275368 6/20 (30%)
C2H2 Zn finger 264..285 CDD:275368 6/20 (30%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
zf-C2H2_8 305..373 CDD:292531 27/67 (40%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 7/19 (37%)
zf-H2C2_2 366..389 CDD:290200 9/22 (41%)
C2H2 Zn finger 382..403 CDD:275368 7/20 (35%)
su(Hw)NP_001247098.1 C2H2 Zn finger 292..313 CDD:275368 4/35 (11%)
COG5048 <312..517 CDD:227381 60/210 (29%)
C2H2 Zn finger 321..341 CDD:275368 2/19 (11%)
zf-C2H2 348..368 CDD:278523 2/19 (11%)
C2H2 Zn finger 350..368 CDD:275368 2/17 (12%)
C2H2 Zn finger 382..402 CDD:275368 6/19 (32%)
C2H2 Zn finger 415..435 CDD:275368 6/20 (30%)
zf-H2C2_2 428..451 CDD:290200 9/23 (39%)
C2H2 Zn finger 443..463 CDD:275368 7/19 (37%)
zf-H2C2_2 455..479 CDD:290200 11/26 (42%)
COG5048 <467..620 CDD:227381 31/87 (36%)
C2H2 Zn finger 471..491 CDD:275368 6/19 (32%)
zf-H2C2_2 484..508 CDD:290200 13/25 (52%)
C2H2 Zn finger 499..519 CDD:275368 7/19 (37%)
C2H2 Zn finger 525..545 CDD:275368 7/20 (35%)
C2H2 Zn finger 555..572 CDD:275368
C2H2 Zn finger 598..615 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446722
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.