DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and CG3281

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster


Alignment Length:436 Identity:118/436 - (27%)
Similarity:182/436 - (41%) Gaps:98/436 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRCCL-LEQPPLYHSLYD--ASSQLAVELKALAPA---LRLEHGD-NLTDVICDLCLRRLHDARD 69
            ||.|| ..:..||  ::|  ..:.|.:||..|..|   |:....| ||...:|..|.|||..|.:
  Fly    15 CRVCLETHETNLY--VHDEIKYNDLKLELWQLLEAVSKLKWTWTDPNLPMHLCQNCARRLIGAYE 77

  Fly    70 FQRRCEHSEQVLRMRHEHWKHTVAVGDALALDDVLECLER-EVGSLEGPMSVPLQASKPVAHVAP 133
            |....|::.:.|:...|. :...|..|.:.: ||:|.::: :|.|    |:..|..|....||. 
  Fly    78 FIVEVENAHETLQNLFEQ-QEVAAKPDEVHV-DVVELIDQDDVVS----MAQYLSTSFAEQHVE- 135

  Fly   134 LMETVDFESLDFQDSSHSEHDI---PSYWESSVDSGSLNTPHHQPETAELFAVEPPTPPESSEE- 194
             ||    |....||.|....|:   |.|.....|.                      .||.|.: 
  Fly   136 -ME----EKYGDQDCSAFTSDVGEEPLYASEDRDD----------------------EPEDSFQL 173

  Fly   195 -PAPDAAEKPKMRRARPRQDNVKPKERKASGAVHPRS-LHPCPECEKKFTRNFQLKLHMTAVHGM 257
             |.||..|..::  :||.|        ..|...|..: ::.|..|.:.|.::..|..|.:..|.:
  Fly   174 KPRPDEIENREL--SRPSQ--------LGSRLNHSANFIYKCAVCPRVFAKSESLTRHFSQAHKL 228

  Fly   258 --------------GEMRYQCEECRKNFASRHSLRYHVKSVH----------STE--------RP 290
                          |.....||.|.:.|..:.:||.|:::.|          :|:        :.
  Fly   229 TADVAAMKLANESCGTGLLTCEHCPRTFKRQDTLRRHMQAFHPDAIALEPEETTDNSARKRIAKR 293

  Fly   291 FGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCD 355
            ..|.||...|.: :.|..|:|.|||: .|  ::|.:|.|::|...||..|||.|..  |||.:|.
  Fly   294 RDCPHCGLSFPV-SSLTIHIRRHTGD-NP--YKCDQCEKAFPRSQDLSLHMRQHTG--ERPSECK 352

  Fly   356 RCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMVR 401
            .|||.|.::..|..|:.:|||::|::|:.|.|.:....:|..||.|
  Fly   353 ICSKKFISQNKLARHMRLHTGQRPYSCKMCSKSFVQSNDLKIHMRR 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 24/76 (32%)
C2H2 Zn finger 234..255 CDD:275368 5/20 (25%)
C2H2 Zn finger 264..285 CDD:275368 7/20 (35%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
zf-C2H2_8 305..373 CDD:292531 27/67 (40%)
C2H2 Zn finger 324..344 CDD:275368 9/19 (47%)
C2H2 Zn finger 354..374 CDD:275368 7/19 (37%)
zf-H2C2_2 366..389 CDD:290200 9/22 (41%)
C2H2 Zn finger 382..403 CDD:275368 7/20 (35%)
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 25/78 (32%)
C2H2 Zn finger 205..226 CDD:275368 5/20 (25%)
C2H2 Zn finger 249..266 CDD:275368 6/16 (38%)
COG5048 <294..>391 CDD:227381 38/102 (37%)
C2H2 Zn finger 296..315 CDD:275368 7/19 (37%)
zf-H2C2_2 307..330 CDD:290200 10/25 (40%)
C2H2 Zn finger 323..343 CDD:275368 9/19 (47%)
zf-H2C2_2 335..358 CDD:290200 13/24 (54%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
zf-H2C2_2 364..388 CDD:290200 9/23 (39%)
C2H2 Zn finger 379..399 CDD:275368 7/20 (35%)
zf-H2C2_2 391..416 CDD:290200 4/8 (50%)
C2H2 Zn finger 407..424 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.