DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and CG8478

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001163576.1 Gene:CG8478 / 41194 FlyBaseID:FBgn0037746 Length:576 Species:Drosophila melanogaster


Alignment Length:351 Identity:80/351 - (22%)
Similarity:121/351 - (34%) Gaps:118/351 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LMETVDFESLDFQDSSHSE--HDIPSYWESSVD-------SGSLNTPHHQPETAEL-FAVEPPTP 188
            :||::|...:|.::::..|  ....|...||||       :.:|.|.....:...| .|.:.|.|
  Fly   130 IMESIDLTQIDDKENTQPEGCGGDNSTLSSSVDVTANTVKANTLKTGDATMDNVSLQEAAKTPAP 194

  Fly   189 ---------------PESSEE-----PAPDAAEKPK--------------MRRARPRQDNVKP-- 217
                           .|.|.|     .:|..|||..              .:..:...|:|||  
  Fly   195 SQVYPLSANVVLENITEVSNEGVSMLVSPAGAEKEVAHVNEVVNEVSELIAKALKISADSVKPAT 259

  Fly   218 --------KERKA-----SGAVHP---RSLHPCPECEKKFTRNFQLKLHMTAV------------ 254
                    |:|::     |||..|   ||..|....|   ||.:..|..|:.|            
  Fly   260 SKLKVEAGKKRQSMSSTYSGAALPRPRRSYLPTTTAE---TRTYSFKQRMSVVVKTTLNSPARKR 321

  Fly   255 ---HGMGEMRYQCEECRKNFASRHSLR--YHVKSVHSTE----RPFGCQHCDRRFILRTQLLSHL 310
               .|:...|..|....|  .::.|:|  ..|.||.|.|    :|                   .
  Fly   322 SVGGGVSLSRRSCLPVSK--LTKSSIRKSLAVTSVRSPEKIASKP-------------------A 365

  Fly   311 RTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHT 375
            :|.|.....::|.|:.||.::..||.|..|||.|:|          ......|...|||: .|..
  Fly   366 KTSTKSIPEKVFSCKNCSTTFRVKSLLDVHMRMHDP----------VDNGANTLKRLNSN-PVAA 419

  Fly   376 GEKPFACEYCDKCYQSVGNLNNHMVR 401
            |.....|::|||.:.....|:.|:::
  Fly   420 GVSKNRCKFCDKNFALERALHIHLMQ 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 6/35 (17%)
C2H2 Zn finger 264..285 CDD:275368 6/22 (27%)
C2H2 Zn finger 293..313 CDD:275368 0/19 (0%)
zf-C2H2_8 305..373 CDD:292531 18/67 (27%)
C2H2 Zn finger 324..344 CDD:275368 9/19 (47%)
C2H2 Zn finger 354..374 CDD:275368 4/19 (21%)
zf-H2C2_2 366..389 CDD:290200 9/22 (41%)
C2H2 Zn finger 382..403 CDD:275368 6/20 (30%)
CG8478NP_001163576.1 zf-C2H2 377..399 CDD:278523 10/21 (48%)
C2H2 Zn finger 379..399 CDD:275368 9/19 (47%)
C2H2 Zn finger 426..444 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.