DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and CG1024

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster


Alignment Length:492 Identity:93/492 - (18%)
Similarity:148/492 - (30%) Gaps:190/492 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LRLEHGDNLTDVICDLCLRR-----LHDARDFQRRCEHSEQVLR-MRHEHWKHTVAVGDALALDD 102
            :.|||.:....|.|.:...|     :|......|..|..|..|| |:.:..|.|.|...|     
  Fly    96 MHLEHSETYRCVHCRMAYTRRRALNVHLLDTHMREIEKYENKLRQMKRQQAKPTTAAAPA----- 155

  Fly   103 VLECLEREVGSLEGPMSV-----------------------------------------PLQASK 126
                     |:.|.||:|                                         |:...|
  Fly   156 ---------GNAEKPMAVKPRGRPKGSTNRKQNDLLQKALMDIDLNTEMEKSPVTALAAPVNEPK 211

  Fly   127 PVAHVAPLMETVDFESLD-----FQDSSHSEHD--IPSYWES-------------SVDSGSLN-- 169
            |:::|:.|       :||     ::|....|..  :|.|.:.             |...|..|  
  Fly   212 PISNVSEL-------NLDRCLNAYEDIVRKEEKEVVPKYDDELDALCKEFFDDGPSAGKGEANEE 269

  Fly   170 ----TPHHQPETAELFAVEPPTPPESSEEPAPDAAEKPKMRRARPRQDNVKPKERKASGAVHPR- 229
                ..|.|....|:..:|            .||..|.::.:.:        ||.|:.....|. 
  Fly   270 QQQDDAHLQQGNQEVVIIE------------IDALGKEEVAQLK--------KEMKSDPISQPTK 314

  Fly   230 ----SLHPCPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTE-- 288
                |..|..:.:.:.:.|...||          :.|.|.:|.|..||....|.||...|..|  
  Fly   315 RRRISTTPSRDSDTEMSTNGLTKL----------ISYLCPKCGKEIASMDGWRAHVFKKHDFEHI 369

  Fly   289 -----------RPFGCQHCDRRFILRTQLLSHLRTHTGEAKP--RIFECQRCSKSWPTKSDLRTH 340
                       |...|..|  |.:..|.:.|.|:.|..:..|  ...:|..|.::..:.|.:..|
  Fly   370 IENSFKILESGRKAMCLQC--REVQPTTVRSQLQKHCFKHLPYRSYLKCTLCDRTKTSTSKILNH 432

  Fly   341 MR-SHNPNMERPFKCDRCSKAFFTRGHLNSHLLV----------HTGEKPFA------------- 381
            :| :|...::|..|               :.||:          .:|:...|             
  Fly   433 IRYNHQEELQRKNK---------------TQLLIKPEPMWASPNKSGQAAMADDAGSEDDQGEQA 482

  Fly   382 -CEYCDKCYQSVGNLNNHMVRLH----ADIIEAQLEA 413
             ||:||:.::|......|:....    ...:|..:||
  Fly   483 VCEHCDRVFRSKWRYERHIASCRRSGAGKSVEGTVEA 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 10/42 (24%)
C2H2 Zn finger 234..255 CDD:275368 3/20 (15%)
C2H2 Zn finger 264..285 CDD:275368 8/20 (40%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
zf-C2H2_8 305..373 CDD:292531 13/70 (19%)
C2H2 Zn finger 324..344 CDD:275368 5/20 (25%)
C2H2 Zn finger 354..374 CDD:275368 2/29 (7%)
zf-H2C2_2 366..389 CDD:290200 8/46 (17%)
C2H2 Zn finger 382..403 CDD:275368 6/20 (30%)
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368
C2H2 Zn finger 73..100 CDD:275368 1/3 (33%)
C2H2 Zn finger 106..123 CDD:275368 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.