DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and CG7386

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster


Alignment Length:485 Identity:118/485 - (24%)
Similarity:173/485 - (35%) Gaps:112/485 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VCRCCLLEQPPLYHSLYDASSQLAV------ELKALAPALRLEHGDNLTDVICDLCLRRLHDARD 69
            :|..||:      |..:.|...|.|      :|:| ..:...:..|.....:|..|..:|:|..|
  Fly    10 LCLTCLV------HLKHGAGHDLFVVPDLFQKLRA-CTSFDADQNDGFPRNLCTQCFTKLNDLHD 67

  Fly    70 FQRRCEHS-EQVLRMRHEHWKHTVAVGDALALDDVLECLER--EVGSLEGPMSVPLQASKPVAHV 131
            |:..|..| :::..|........:.|.:::|.|.  |..||  |..|.:..::..|:.......|
  Fly    68 FRELCAESIKRLKEMMTSQRNMPMGVFESIADDS--EAPERPEEPASFDPLLNNKLEMIDNEEDV 130

  Fly   132 APLMETVDFESLDFQDSSHSEHDIPSYWESSVDSGSLNTPHHQPETAELFAVEPPTPPESSEEPA 196
            ..|:|.||.|..:.......||         ..|...|....:.:.:|.|        .|.:|.|
  Fly   131 FKLLEKVDKELEEHSRDQSEEH---------FSSAEHNGLEEEKKESEGF--------NSDDEQA 178

  Fly   197 PD----AAEKPKMRRARP---RQDNVKPKERKASGAVHPRSLHP--CPE--CEKKFTRNFQLKLH 250
            ..    |.:|.|:.|...   .|...|.:.:......|...|.|  |.|  |.|.||....|:||
  Fly   179 MGQRRIANDKRKLFRLMSCSICQQKFKKQSKFEEHMKHHNDLLPFQCQEESCRKGFTTAGALRLH 243

  Fly   251 MTAVHGMGEMRYQC--EECRKNFASRHSLRYHVKSVHSTER---PFG---CQHCDRRFILRTQLL 307
            :...|...|....|  |.|:..|:....|..|:|.||:..|   |.|   |:.|...|.....:.
  Fly   244 VDYAHSKKEDTVPCTVEGCQLVFSRLRLLTIHLKKVHNQARVIAPRGEQSCKECGVVFRCPVAMK 308

  Fly   308 SHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHN--------------------------P 346
            .|:.|||||..|  :.|..|.|.:...|.|:.|:..|.                          .
  Fly   309 KHMYTHTGEELP--YPCTICGKGFYINSALKNHLLRHAGIKNYVCQYCGVRKTTRQEWSKHILIH 371

  Fly   347 NMERPFKCDRCSKAFFTRGHLNSHL-----------------------------LVHTGEKPFAC 382
            .....|||..|..|..|:..|.||:                             :.|||||...|
  Fly   372 TQRNQFKCRICDYATHTKRVLESHVKIVHEKIRNFACQYCGKTFGKAYACKIHEMAHTGEKRCEC 436

  Fly   383 EYCDKCYQSVGNLNNHMVRLHADIIEAQLE 412
            :.|||.:....:||||: ::|...:|..||
  Fly   437 KVCDKKFLHSESLNNHL-KIHEKSVERALE 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 18/77 (23%)
C2H2 Zn finger 234..255 CDD:275368 9/22 (41%)
C2H2 Zn finger 264..285 CDD:275368 7/22 (32%)
C2H2 Zn finger 293..313 CDD:275368 4/19 (21%)
zf-C2H2_8 305..373 CDD:292531 23/122 (19%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 7/48 (15%)
zf-H2C2_2 366..389 CDD:290200 12/51 (24%)
C2H2 Zn finger 382..403 CDD:275368 8/20 (40%)
CG7386NP_648036.1 zf-AD 10..81 CDD:214871 18/77 (23%)
C2H2 Zn finger 197..217 CDD:275368 2/19 (11%)
C2H2 Zn finger 294..314 CDD:275368 4/19 (21%)
C2H2 Zn finger 323..343 CDD:275368 6/19 (32%)
C2H2 Zn finger 351..371 CDD:275368 0/19 (0%)
C2H2 Zn finger 379..400 CDD:275368 7/20 (35%)
C2H2 Zn finger 408..428 CDD:275368 0/19 (0%)
C2H2 Zn finger 436..456 CDD:275368 8/20 (40%)
C2H2 Zn finger 534..555 CDD:275368
C2H2 Zn finger 563..583 CDD:275368
zf-H2C2_2 575..600 CDD:290200
C2H2 Zn finger 591..611 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446651
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.