DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and CG10543

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001369100.1 Gene:CG10543 / 37379 FlyBaseID:FBgn0034570 Length:1666 Species:Drosophila melanogaster


Alignment Length:406 Identity:82/406 - (20%)
Similarity:150/406 - (36%) Gaps:113/406 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HSEQVLRMRHEHWKHTVAVGDALALDDVLECLER--EVGSLEGPMSVPLQASKPVAHVAPLMETV 138
            |..|::.|..:..:|..::.::..: ..|..|..  :..::.|.::..|:              :
  Fly   609 HQRQMMMMPEDFPQHGASMMNSRQM-PALAALSNLGDTPAMSGQLNSSLE--------------L 658

  Fly   139 DFESL----DFQDSSHSEHDIPSYWESSVDSGSLNTPHHQPETAELFAVEPP------------- 186
            |...|    |..|..|...::.:..:..:|.||.::...|         .||             
  Fly   659 DDNDLSADEDDDDLDHDLDELDAAKQQLIDGGSSSSTSLQ---------APPSQHGSGSGGSGGQ 714

  Fly   187 TPPESSEEPAPDAAEKPK-MRRARPRQDNVKPKERKASGAVHP---------------------R 229
            ||....::|:.:....|| .|:.:...|:.|         :||                     |
  Fly   715 TPGSKKDKPSYNCLLCPKSYRKRKSLLDHYK---------MHPGYCHDCGQRNGNTLEEIIHHNR 770

  Fly   230 SLH------PCPECEKKFTRNFQLKLHMTAVHGMGEMR-------------------YQ------ 263
            ::|      .|..|.:.::|..|...|:.: |...|::                   ::      
  Fly   771 TMHVKEFPFVCETCGESYSRKQQFHAHVES-HNKKEIKTFPCGECGLKFPQKKLQQHFEETGHKA 834

  Fly   264 ----CEECRKNFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFEC 324
                ||.|.:.|.|:::|..|:..||..:..|.|..|..||.|:..|..|::.||...:|  :.|
  Fly   835 DGAICEVCGEEFQSKNALYQHIIRVHKRDNFFECHICHNRFTLKANLERHVQLHTEIKRP--YVC 897

  Fly   325 QRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCY 389
            ..|..|:.|...|:.|..:.:.::.. .||..|.|.|.:...|..||..|:.|:|..|.|||:.:
  Fly   898 DLCGSSYFTYPALKEHYSNAHVDVSE-CKCTLCGKRFGSAKSLQRHLPSHSEERPHCCNYCDQTF 961

  Fly   390 QSVGNLNNHMVRLHAD 405
            :...:|..|...:|.:
  Fly   962 KWKTHLVRHKQTMHGN 977

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 2/5 (40%)
C2H2 Zn finger 234..255 CDD:275368 5/20 (25%)
C2H2 Zn finger 264..285 CDD:275368 7/20 (35%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
zf-C2H2_8 305..373 CDD:292531 19/67 (28%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 7/19 (37%)
zf-H2C2_2 366..389 CDD:290200 10/22 (45%)
C2H2 Zn finger 382..403 CDD:275368 6/20 (30%)
CG10543NP_001369100.1 C2H2 Zn finger 727..747 CDD:275368 5/28 (18%)
C2H2 Zn finger 751..773 CDD:275368 1/21 (5%)
C2H2 Zn finger 781..801 CDD:275368 5/20 (25%)
PHA00733 <804..860 CDD:177301 8/55 (15%)
C2H2 Zn finger 811..827 CDD:275368 0/15 (0%)
C2H2 Zn finger 839..860 CDD:275368 7/20 (35%)
C2H2 Zn finger 868..888 CDD:275368 7/19 (37%)
C2H2 Zn finger 897..913 CDD:275368 5/15 (33%)
C2H2 Zn finger 926..946 CDD:275368 7/19 (37%)
C2H2 Zn finger 954..975 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.