DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and az2

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster


Alignment Length:168 Identity:56/168 - (33%)
Similarity:81/168 - (48%) Gaps:7/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 CPECEKKFTRNFQLKLHMTAVHGMGEMR-YQCEECRKNFASRHSLRYHVKSVHSTERPFGCQHCD 297
            |..||..|:.:..|:.|....|.||:.. ::|..|..||..:..|:.|.:.|| .::.|.|:.|.
  Fly   377 CEVCEHSFSTDHALQAHQFRDHKMGDGGWFRCTLCELNFDRKCHLQQHSQRVH-MDKSFVCEICS 440

  Fly   298 RRFILRTQLLSHLRTHTGE--AKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKA 360
            |.|....||..|.|||..:  |||  |.|:.|.|.:..|..:.||:.:.:..: |.||||.|.|.
  Fly   441 RSFAFGNQLAIHKRTHDEKHVAKP--FVCEFCGKCFKQKIQMTTHVTAVHTKI-RAFKCDMCPKD 502

  Fly   361 FFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNH 398
            |.|:..|..|:..|...:...||.|.|.:.:...|..|
  Fly   503 FLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNANALVKH 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 6/20 (30%)
C2H2 Zn finger 264..285 CDD:275368 6/20 (30%)
C2H2 Zn finger 293..313 CDD:275368 8/19 (42%)
zf-C2H2_8 305..373 CDD:292531 27/69 (39%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 8/19 (42%)
zf-H2C2_2 366..389 CDD:290200 7/22 (32%)
C2H2 Zn finger 382..403 CDD:275368 6/17 (35%)
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510
GT1 276..>341 CDD:304916
C2H2 Zn finger 377..398 CDD:275368 6/20 (30%)
C2H2 Zn finger 408..429 CDD:275368 6/20 (30%)
C2H2 Zn finger 436..456 CDD:275368 8/19 (42%)
C2H2 Zn finger 467..488 CDD:275368 6/20 (30%)
C2H2 Zn finger 496..516 CDD:275368 8/19 (42%)
C2H2 Zn finger 524..544 CDD:275368 6/17 (35%)
C2H2 Zn finger 551..572 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.