DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and CG31612

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001163042.1 Gene:CG31612 / 35427 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster


Alignment Length:218 Identity:68/218 - (31%)
Similarity:99/218 - (45%) Gaps:40/218 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 PKE-RKASGAVHPRS-----LHPCPECEKKFTRNFQLKLHMTAVHG----------------MGE 259
            ||. :|.|...|.|:     :..|.||.:||.|...||.|:...|.                ..:
  Fly   735 PKNFKKHSLRAHLRNHTNEKIFECTECLQKFARRHNLKNHVITKHAKVGDKEKKKYAAKDVEQSK 799

  Fly   260 MRYQCEECRKNFASRHSLRYHVKSVHS--TERPFGCQHCDRRFILRT--QLLSHLRTHTGEAKPR 320
            .:|||..|.|..|.::||:.|..| ||  .||.:.|...|..:..||  .|.:||.:|:.|.   
  Fly   800 PKYQCGTCGKLLAKKYSLKLHEIS-HSKAVERNYLCHFADCSYAGRTPESLKTHLVSHSQEN--- 860

  Fly   321 IFECQRCSKSWPTKSDLRTHMRSH-------NPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEK 378
             .:|.|.:.|:..||:|  |::.|       ..|.|..|.||:|......:|||..|.|.|:|:|
  Fly   861 -HKCARINCSYVGKSEL--HLKRHLKSAHSTEKNGEEWFSCDQCDFRARIKGHLRRHSLRHSGQK 922

  Fly   379 PFACEYCDKCYQSVGNLNNHMVR 401
            |..|.:||....::.||..|:::
  Fly   923 PHQCPHCDFQCSTIDNLRKHIIK 945

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 9/20 (45%)
C2H2 Zn finger 264..285 CDD:275368 8/20 (40%)
C2H2 Zn finger 293..313 CDD:275368 7/21 (33%)
zf-C2H2_8 305..373 CDD:292531 23/74 (31%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 354..374 CDD:275368 8/19 (42%)
zf-H2C2_2 366..389 CDD:290200 11/22 (50%)
C2H2 Zn finger 382..403 CDD:275368 6/20 (30%)
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368
C2H2 Zn finger 731..750 CDD:275368 6/14 (43%)
C2H2 Zn finger 758..779 CDD:275368 9/20 (45%)
C2H2 Zn finger 804..824 CDD:275368 8/20 (40%)
C2H2 Zn finger 834..856 CDD:275368 7/21 (33%)
C2H2 Zn finger 898..918 CDD:275368 8/19 (42%)
zf-H2C2_2 910..935 CDD:290200 11/24 (46%)
C2H2 Zn finger 926..945 CDD:275368 6/18 (33%)
C2H2 Zn finger 957..984 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.