DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and CG17328

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster


Alignment Length:414 Identity:105/414 - (25%)
Similarity:156/414 - (37%) Gaps:143/414 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VCRCCLLEQPPLYHSLY--DASSQLAVELKALAPALRLEHGDNLTDVICDLCLRRLHDARDFQRR 73
            :||.||.|..|: .|:|  |.:...:|.|...| .:|:...|.|..|||:.|:.||..|..|::.
  Fly     8 ICRVCLEELHPV-TSIYSTDFAMMPSVMLMQCA-KIRVFKTDGLPSVICNNCIYRLGVAFHFKQE 70

  Fly    74 CEHSEQVLRMRH-----EHWKHTVAVGDALALDDVLECLEREVGSLEGPMSVPLQASKPVAHVAP 133
            ||:|:  ||:|.     |.|:...|.                                       
  Fly    71 CENSD--LRLRQYLGILESWRQDAAT--------------------------------------- 94

  Fly   134 LMETVDFESLDFQDSSHSEHDIPSYWESSVDSGSLNTPHHQPETAELFAVEPPTPP--ESSEEPA 196
                    :.||                                     ||.|..|  :|.||..
  Fly    95 --------NTDF-------------------------------------VEKPLLPQRDSDEEEP 114

  Fly   197 PDAAEKPKMRRARPRQDNVKPKERKASGAVHPRSLHPCPECEKKFTRNFQLKLHMTAVHGMGEMR 261
            .||    |:.:.|.|.....|:|.|..|   |:   |.|                       :|.
  Fly   115 VDA----KVSKRRSRYQRKPPEEHKKRG---PK---PVP-----------------------KMP 146

  Fly   262 YQCEECRKNFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQR 326
            :.|.||.|:|.....|..|::: |:.|:|:.|..|.:||..:..|..|.|||||: ||  |:|:.
  Fly   147 HTCYECHKSFKCIAQLTQHIRT-HTGEKPYQCSFCIQRFAQKYNLKVHERTHTGD-KP--FQCEI 207

  Fly   327 CSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQS 391
            |||.:....:.:.|.:.|..  .|...|..|.|.|:|.|.|:.|::.|||.|...|:.|.|.:..
  Fly   208 CSKQFSALGNFQAHQKIHLG--VRDQVCSLCQKGFYTAGDLSKHMITHTGIKNHHCDVCGKAFSR 270

  Fly   392 VGNLNNHMVRLHA-------DIIE 408
            ..::..|.::||.       ||::
  Fly   271 RRDMRTHKLKLHPLESSTNHDIVD 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 26/72 (36%)
C2H2 Zn finger 234..255 CDD:275368 1/20 (5%)
C2H2 Zn finger 264..285 CDD:275368 7/20 (35%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
zf-C2H2_8 305..373 CDD:292531 25/67 (37%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
C2H2 Zn finger 354..374 CDD:275368 8/19 (42%)
zf-H2C2_2 366..389 CDD:290200 9/22 (41%)
C2H2 Zn finger 382..403 CDD:275368 4/20 (20%)
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 28/75 (37%)
COG5048 146..>211 CDD:227381 27/68 (40%)
C2H2 Zn finger 149..169 CDD:275368 7/20 (35%)
C2H2 Zn finger 177..197 CDD:275368 7/19 (37%)
zf-H2C2_2 189..213 CDD:404364 14/26 (54%)
C2H2 Zn finger 205..225 CDD:275368 5/19 (26%)
C2H2 Zn finger 233..253 CDD:275368 8/19 (42%)
zf-H2C2_2 245..270 CDD:404364 9/24 (38%)
C2H2 Zn finger 261..282 CDD:275368 4/20 (20%)
C2H2 Zn finger 318..338 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446700
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.