DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and CG15436

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster


Alignment Length:397 Identity:110/397 - (27%)
Similarity:166/397 - (41%) Gaps:116/397 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VCRCCLLEQPPLYHSLYDASSQLAV---ELKALAPALRLEHGDNLTDVICDLCLRRLHDARDFQR 72
            :||.|:.....|. :::||..:..|   |:.|......::.||..:::||..|...:..|...::
  Fly     4 ICRVCMDISGKLV-NIFDARRRTRVSIAEMIAQCTGFEVKRGDLFSEMICPQCYEDVKSAYGIRQ 67

  Fly    73 RCEHSEQ-VLRMRHEHWKHTVAVGDALALDDVLECLEREVGSLEGPMSVPLQASKPVAHVAPLME 136
            .||.|.| ..|:|.|      .:.|||                                 ..|:|
  Fly    68 TCEESHQFYCRVRDE------GIEDAL---------------------------------CALLE 93

  Fly   137 TVDFESLDFQDSSHSEHDIPSYWESSVDSGSLNTPHHQPETAELFAVEPPTPPESSEEPAPDAAE 201
            ..|:|..:.:|             :.:||.|                               ||:
  Fly    94 EEDWEISEDED-------------ARIDSAS-------------------------------AAD 114

  Fly   202 KPKMRRARPRQDNVKPKERKASGAVHPRSLHPCPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEE 266
                       |:.|...:|.:        ..|.||.||:.|......|| ..| |....:.|..
  Fly   115 -----------DDGKSDSKKVA--------FECRECHKKYQRKGTFLRHM-RTH-MDGQSFPCPY 158

  Fly   267 CRKNFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSW 331
            |::||..|.:|:.|:|: |:..:|:.|.||.:.|..::.|.||.||||||   |.|:|.:|||::
  Fly   159 CKRNFRLRVTLKAHMKT-HNAAKPYECSHCAKTFAQQSTLQSHERTHTGE---RPFKCSQCSKTF 219

  Fly   332 PTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLN 396
            ...||||.|:|:|  ..||||||.:|:|.|..:.||::|...||||:||.|.:|.|.:....:|.
  Fly   220 IKSSDLRRHIRTH--GSERPFKCSKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLK 282

  Fly   397 NHMVRLH 403
            .|. |||
  Fly   283 QHS-RLH 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 19/74 (26%)
C2H2 Zn finger 234..255 CDD:275368 8/20 (40%)
C2H2 Zn finger 264..285 CDD:275368 8/20 (40%)
C2H2 Zn finger 293..313 CDD:275368 8/19 (42%)
zf-C2H2_8 305..373 CDD:292531 34/67 (51%)
C2H2 Zn finger 324..344 CDD:275368 10/19 (53%)
C2H2 Zn finger 354..374 CDD:275368 7/19 (37%)
zf-H2C2_2 366..389 CDD:290200 12/22 (55%)
C2H2 Zn finger 382..403 CDD:275368 6/20 (30%)
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 19/74 (26%)
C2H2 Zn finger 128..148 CDD:275368 8/20 (40%)
C2H2 Zn finger 156..176 CDD:275368 8/20 (40%)
COG5048 <180..341 CDD:227381 53/115 (46%)
C2H2 Zn finger 184..204 CDD:275368 8/19 (42%)
zf-H2C2_2 197..219 CDD:290200 15/24 (63%)
C2H2 Zn finger 212..232 CDD:275368 10/19 (53%)
zf-H2C2_2 224..249 CDD:290200 15/26 (58%)
C2H2 Zn finger 240..260 CDD:275368 7/19 (37%)
zf-H2C2_2 252..276 CDD:290200 12/23 (52%)
C2H2 Zn finger 268..288 CDD:275368 6/20 (30%)
C2H2 Zn finger 296..316 CDD:275368
C2H2 Zn finger 324..341 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446578
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.