DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and CG17612

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_608824.1 Gene:CG17612 / 33639 FlyBaseID:FBgn0031597 Length:618 Species:Drosophila melanogaster


Alignment Length:455 Identity:94/455 - (20%)
Similarity:164/455 - (36%) Gaps:125/455 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRCCLLEQPPLYHSLYDASSQLAVELKALA---PALRLEHGDNLTDVICDLCLRRLHDARDFQRR 73
            ||.| |||.....:::|.:.|..:.:..:.   ..:.:|.||:.::.||..||..:.:|.|....
  Fly   187 CRVC-LEQSDNLTNIFDDAHQYGIPIATILSQYTGMPVEKGDSFSEYICVTCLDVVKNAFDDLES 250

  Fly    74 CEHSEQVLRMRHEHWKHTVAVGDALALDDVLECLEREVGSLEGPMSVPLQASKPVAHVAPLMETV 138
            .|::.|:.|...|         :.:.:|                 |:|:: :|||          
  Fly   251 KENTIQMYRQPKE---------EIIDID-----------------SIPVK-NKPV---------- 278

  Fly   139 DFESLDFQDSSHSEHDIPSYWESSVDSGSLNT---PHHQPETAELFAVEPPTPP----------- 189
                 |::.:....|..|...:..:.:..|..   .|::..|.|...::.|..|           
  Fly   279 -----DYEVTGKPPHRCPQCPKIFLLAAKLQAHIRTHNETRTTEPPRLKCPMCPSIYMKRGCLEA 338

  Fly   190 -----------ESSEEPAPDAAEKPKM--------RRARPRQDNVKPKERKASGAVHPRSLHPCP 235
                       ||..||.......||:        ...:..:|..:...||:|        |.|.
  Fly   339 HMWIHRASDERESELEPPYRCPHCPKLFLYSSFLEIHIQTHEDVSQRLSRKSS--------HKCA 395

  Fly   236 ECEKKFTRNFQLKLHM-----------------------TAVHGMGEMRYQCEECRKNFASRHSL 277
            :|...|:....||.|:                       ...|.....|::|.:|.|.|.|::.|
  Fly   396 QCADVFSDVSSLKDHVKIHAGERTFKCPLCLMSFQEESNLKSHDCAHTRFKCHKCSKFFESQNYL 460

  Fly   278 RYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHT------GEAKPRIFECQRCSKSWPTKSD 336
            .:|.|..|:|:.||.|..|.:.|..|..|..|:.:..      .::..:||.|.:|.|.:..:.:
  Fly   461 DFHFKKSHTTKGPFKCIKCQQTFQKRNGLKEHISSQVCVQFLRSKSPGQIFPCPKCPKKFSIEDN 525

  Fly   337 LRTHMRSH---NPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNH 398
            .:.|..:|   ...:|| ..|.:|.|::..:..|..|:|.|.     .|.:|...:.|...|..|
  Fly   526 YQMHHATHKKVKTVIER-HNCTQCKKSYQNKKLLTKHILSHN-----RCVHCSMSFTSKYLLEQH 584

  Fly   399  398
              Fly   585  584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 19/72 (26%)
C2H2 Zn finger 234..255 CDD:275368 6/43 (14%)
C2H2 Zn finger 264..285 CDD:275368 8/20 (40%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
zf-C2H2_8 305..373 CDD:292531 16/76 (21%)
C2H2 Zn finger 324..344 CDD:275368 4/19 (21%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
zf-H2C2_2 366..389 CDD:290200 6/22 (27%)
C2H2 Zn finger 382..403 CDD:275368 5/17 (29%)
CG17612NP_608824.1 zf-AD 187..>246 CDD:285071 16/59 (27%)
C2H2 Zn finger 290..310 CDD:275368 2/19 (11%)
C2H2 Zn finger 323..343 CDD:275370 2/19 (11%)
zf-C2H2_8 356..438 CDD:292531 13/89 (15%)
C2H2 Zn finger 359..379 CDD:275368 2/19 (11%)
C2H2 Zn finger 394..414 CDD:275368 6/19 (32%)
C2H2 Zn finger 422..438 CDD:275368 0/15 (0%)
C2H2 Zn finger 447..463 CDD:275368 6/15 (40%)
C2H2 Zn finger 476..505 CDD:275368 6/28 (21%)
C2H2 Zn finger 513..533 CDD:275368 4/19 (21%)
C2H2 Zn finger 545..565 CDD:275368 6/19 (32%)
C2H2 Zn finger 568..584 CDD:275368 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446693
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.