DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and CG1529

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster


Alignment Length:409 Identity:108/409 - (26%)
Similarity:162/409 - (39%) Gaps:89/409 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TDV--ICDLCLRRLHDARDFQRRCEHSE-----------QVLRMRHE---------HWKHTVAVG 95
            ||:  :|.:|||.|   ||....|....           .:|:..|.         |        
  Fly     6 TDLARLCRICLRHL---RDRDTHCPDPRLIAILQKLLDIDILKQPHGFPTEICNLCH-------- 59

  Fly    96 DALALDDVLECLEREVGSLEGPMSVPLQASKPV-AHVAPLMETVDFESLDFQDSSHSEHDIPSYW 159
            :|:...|.|..:.||       .|..|...:|| ..|..:.|....|.|. ::...:||::....
  Fly    60 NAVVYFDELRQVARE-------SSQKLIGWQPVDIAVDRVKEEPPDEGLK-ENHEENEHELEEEH 116

  Fly   160 ESSVDSGSLNTPHHQPETAELFAVEPPTPPESSEEPAPDAAEKPKM---------RRARPRQDNV 215
            |...|...::....|.:..::.       .:..:|..||..|..:.         |||....|..
  Fly   117 EKQADGQQVDLSKKQEDQKKIL-------DDREDEEYPDEYENSQQQLSQGTGSKRRAGLACDQC 174

  Fly   216 KPKERKASG-AVHPRSLHP-------CPECEKKFTRNFQLKLHMTAVHGMGEMRYQ------CEE 266
            ..:..|... ..|.||:|.       |..|:|.|||..||:.||...|...|...|      ||.
  Fly   175 GKQVYKLPYLEAHIRSVHQGYSKPFLCRSCDKSFTRYEQLRSHMRNAHPQLEQLQQELRDLICEL 239

  Fly   267 CRKNFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTH--TGEAKPRIFECQRCSK 329
            |.:.::::::|..|:|. |:..:...|:||....:.||:||:|||||  |.|.    |:|::|.:
  Fly   240 CNRQYSTKNALGEHLKR-HAQRKEHVCEHCGVAKVTRTELLTHLRTHNPTWER----FKCEQCPQ 299

  Fly   330 SWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHT-----GEK----PFACEYC 385
            .:..||.:..|:|..:.. :|.|:|..|.|.|.|......|..:||     ||.    ||||.:|
  Fly   300 LFRHKSAISRHVRVVHEG-QRRFQCGHCEKKFGTHASQVRHERLHTESTGSGEAAEEWPFACIHC 363

  Fly   386 DKCYQSVGNLNNHMVRLHA 404
            .|...|...|..|:.|..|
  Fly   364 QKPCVSRQTLELHLRRHRA 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 10/41 (24%)
C2H2 Zn finger 234..255 CDD:275368 10/20 (50%)
C2H2 Zn finger 264..285 CDD:275368 6/20 (30%)
C2H2 Zn finger 293..313 CDD:275368 10/19 (53%)
zf-C2H2_8 305..373 CDD:292531 24/69 (35%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
zf-H2C2_2 366..389 CDD:290200 11/31 (35%)
C2H2 Zn finger 382..403 CDD:275368 7/20 (35%)
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071 17/85 (20%)
C2H2 Zn finger 171..192 CDD:275368 5/20 (25%)
zf-C2H2_2 201..>257 CDD:289522 19/56 (34%)
C2H2 Zn finger 201..222 CDD:275368 10/20 (50%)
C2H2 Zn finger 237..257 CDD:275368 6/20 (30%)
C2H2 Zn finger 265..285 CDD:275368 10/19 (53%)
zf-C2H2_8 268..349 CDD:292531 29/85 (34%)
C2H2 Zn finger 294..315 CDD:275368 6/20 (30%)
C2H2 Zn finger 323..343 CDD:275368 6/19 (32%)
C2H2 Zn finger 360..380 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.