DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and CG2120

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster


Alignment Length:307 Identity:76/307 - (24%)
Similarity:111/307 - (36%) Gaps:102/307 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 SEHDIPSYWESSVDSGSL---NTPHHQPETAELFAVEPPTPPESSEEPAPDAAEKPKMRRARPRQ 212
            ||:|:     ..:.:|:|   ||..|:|                     .|.. ||| |....::
  Fly    55 SEYDL-----LELVNGALQQRNTTEHKP---------------------TDMC-KPK-RTPTTKR 91

  Fly   213 DNVKPKERKASGAVHPRSLHPCPECEKKFTRNFQLKLH-MTAVHGMGEMRYQCEECRKNFASRHS 276
            .....|:            |.|..|:::|:..:.|::| ||..   .|..:.|.||.|.|...:.
  Fly    92 HRTTGKD------------HTCDICDRRFSEAYNLRIHKMTHT---DEKPHVCVECGKGFRQLNK 141

  Fly   277 LRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKP------------------RI-- 321
            ||.|..: |:.|||..|..|.:.|.....|..|.|.|||| ||                  ||  
  Fly   142 LRIHAVT-HTAERPHKCDICGKGFRYANYLTVHRRLHTGE-KPYPCLATDCHLSFHSIHARRIHT 204

  Fly   322 ----------------------------FECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDR-- 356
                                        |.|..||:....:..|..|::.|  ..:|.|.|.:  
  Fly   205 KLRHAAQTDPDPEHPLAEQEQRDTSALSFTCPVCSRVLTDQCYLSIHLKRH--YNQRDFPCPQPE 267

  Fly   357 CSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMVRLH 403
            |.|.||:...|..|.:.||.::||||..|...:....|...|: ::|
  Fly   268 CGKRFFSASELKHHQIAHTQQRPFACPLCPARFLRKSNHKQHL-KVH 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 7/21 (33%)
C2H2 Zn finger 264..285 CDD:275368 8/20 (40%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
zf-C2H2_8 305..373 CDD:292531 27/117 (23%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
C2H2 Zn finger 354..374 CDD:275368 7/21 (33%)
zf-H2C2_2 366..389 CDD:290200 9/22 (41%)
C2H2 Zn finger 382..403 CDD:275368 4/20 (20%)
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 6/19 (32%)
zf-H2C2_2 113..138 CDD:290200 10/27 (37%)
C2H2 Zn finger 129..149 CDD:275368 8/20 (40%)
zf-H2C2_2 142..166 CDD:290200 10/24 (42%)
COG5048 151..>264 CDD:227381 26/115 (23%)
C2H2 Zn finger 157..177 CDD:275368 6/19 (32%)
C2H2 Zn finger 185..206 CDD:275368 2/20 (10%)
C2H2 Zn finger 235..255 CDD:275368 5/19 (26%)
C2H2 Zn finger 263..285 CDD:275368 7/21 (33%)
C2H2 Zn finger 293..313 CDD:275368 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.