DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and CG11398

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster


Alignment Length:186 Identity:54/186 - (29%)
Similarity:76/186 - (40%) Gaps:10/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 KPKERKASGAVHPRSLHPCPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYH 280
            :|..|...|...|.|.|.|..|.:.|.::..|..||.|.:.:  ..|.|.||...|..|.:...|
  Fly    69 RPTHRYQGGQQTPASEHACDACGRVFQKHNALVDHMNAHNDV--RNYPCPECPARFVQRSNRECH 131

  Fly   281 VKSVHSTERPFGCQH--CDRRFILRTQLLSHLRT-HTGEAKPRIFECQRCSKSWPTKSDLRTHMR 342
            :|:||.......|..  |.:||..|.:...|::| |..|   |...|..||..:....:.|.|:.
  Fly   132 LKNVHRKVYLHSCPEPGCKKRFQQRRECDQHVKTVHQNE---RNLVCDTCSARFSHPVNYRKHLA 193

  Fly   343 SHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNH 398
            ||  ...:.:.|..|.|.|....:.:.||.||:..|.:.|..|...|.....|..|
  Fly   194 SH--GSAKSYGCPICGKLFGRPENRDVHLFVHSICKAYICSVCGADYMRRNQLIRH 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 7/20 (35%)
C2H2 Zn finger 264..285 CDD:275368 7/20 (35%)
C2H2 Zn finger 293..313 CDD:275368 7/22 (32%)
zf-C2H2_8 305..373 CDD:292531 18/68 (26%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
zf-H2C2_2 366..389 CDD:290200 7/22 (32%)
C2H2 Zn finger 382..403 CDD:275368 5/17 (29%)
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 1/2 (50%)
C2H2 Zn finger 87..107 CDD:275368 6/19 (32%)
C2H2 Zn finger 115..136 CDD:275368 7/20 (35%)
C2H2 Zn finger 144..165 CDD:275368 6/20 (30%)
C2H2 Zn finger 175..195 CDD:275368 5/19 (26%)
C2H2 Zn finger 203..223 CDD:275368 6/19 (32%)
C2H2 Zn finger 231..247 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446602
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.