DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and Opbp

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster


Alignment Length:538 Identity:119/538 - (22%)
Similarity:176/538 - (32%) Gaps:205/538 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ASSQLAVELKALAPALRLEHGD------NLTDVICDLCLRRLHDARDFQRRCEHSEQVLRMRHEH 87
            :||..|.|   ..|.|.:|.||      ....:.|:.|.....|...:.|  .|..|.       
  Fly     2 SSSNQAEE---TTPNLHVEDGDLSGGALQQEFLYCESCGNVYEDTESYDR--AHGPQA------- 54

  Fly    88 WKHTVAVGDALALDDVLE-CLEREVGS--------------LEGPMSVPLQ-------------- 123
            ...|.|.|:...:::|.| |:..|||.              .|.|.:|..:              
  Fly    55 GCCTGASGELDFIEEVAEDCISEEVGEEDIVYADVPLWELVEEVPANVKAEKDQNEPSNSDRYFC 119

  Fly   124 ---------ASKPVAHVAPLME-----------------------------------------TV 138
                     .:|...|:.|..|                                         ||
  Fly   120 YDCHSIFENRNKAEEHICPRAESGGSSQQDGDAKAPVRRKLASVSARTGPRDASSVISCGICNTV 184

  Fly   139 DFESLDF----------------QDS----SHSEH-DIPSYW----ESSVDSGSLNTPH---HQP 175
             |.|..|                ||:    :|.:: ::..::    ..|.|. :|.|.|   ||.
  Fly   185 -FSSEKFLKFHMRIHENRAPKSIQDALPIGAHQQYSELDQFYCEICNKSFDE-TLLTVHKQMHQQ 247

  Fly   176 ETAELFAV-------------------EPPTPPESSEEPAPDAAEKPKMRRARPRQDNVKPKERK 221
            |::|:...                   |.|...|||.:.|           .|...|..||.   
  Fly   248 ESSEIMCSICNRKFENEVTYQMHQKIHEKPRDSESSRKLA-----------QRTSLDKEKPG--- 298

  Fly   222 ASGAVHPRSLHPCPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHS 286
                      .||..||:.|||.|: |:....|| .||..|.||.|.|.|...:||..|::: |:
  Fly   299 ----------FPCQYCERVFTRPFE-KVKHERVH-TGEKPYACEVCGKTFRVSYSLTLHLRT-HT 350

  Fly   287 TERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERP 351
            ..||:.|..|::||........|||.|:.|   |.|.|..|.|::.|...|..|..:|.    :|
  Fly   351 NIRPYVCTVCNKRFKSHQVYSHHLRIHSSE---RQFSCDACPKTFRTSVQLYAHKNTHT----KP 408

  Fly   352 FKCDRCSKAFFTRGHLNSHLLVH--------------------TGEKPFACE-YCDKC---YQSV 392
            ::|..|::.|.:...:.:|:..|                    |.:...|.: ||:.|   |..:
  Fly   409 YRCAVCNRPFSSMYAVKNHMQTHKEISSKGSVGSGTPNIKSAATSKSQAAGKFYCNTCGAEYARL 473

  Fly   393 GNLNNHMVRLHADIIEAQ 410
            ..|..||...|. ::|.|
  Fly   474 FALRLHMKSAHG-LVEEQ 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 15/58 (26%)
C2H2 Zn finger 234..255 CDD:275368 8/20 (40%)
C2H2 Zn finger 264..285 CDD:275368 8/20 (40%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
zf-C2H2_8 305..373 CDD:292531 19/67 (28%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 4/19 (21%)
zf-H2C2_2 366..389 CDD:290200 7/46 (15%)
C2H2 Zn finger 382..403 CDD:275368 7/24 (29%)
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 0/19 (0%)
C2H2 Zn finger 301..321 CDD:275368 8/20 (40%)
zf-H2C2_2 316..336 CDD:290200 9/20 (45%)
C2H2 Zn finger 329..349 CDD:275368 8/20 (40%)
zf-H2C2_2 341..366 CDD:290200 10/25 (40%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
C2H2 Zn finger 411..431 CDD:275368 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.