Sequence 1: | NP_610211.1 | Gene: | CG30431 / 35549 | FlyBaseID: | FBgn0050431 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491744.3 | Gene: | let-391 / 182953 | WormBaseID: | WBGene00006492 | Length: | 453 | Species: | Caenorhabditis elegans |
Alignment Length: | 206 | Identity: | 55/206 - (26%) |
---|---|---|---|
Similarity: | 86/206 - (41%) | Gaps: | 19/206 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 210 PRQDNVKPKERKASGAVHPRSLHPC-PECEKKFTRNFQ----LKLHMTAVHGMGEMRYQCEECRK 269
Fly 270 NFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTK 334
Fly 335 SDLRTHMRSHNPNMERPFKCD-RCSKAFFTRGHLNSH-LLVHTGEKPFAC--EYCDKCYQSVGNL 395
Fly 396 NNHMVRLHADI 406 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30431 | NP_610211.1 | zf-AD | 11..82 | CDD:285071 | |
C2H2 Zn finger | 234..255 | CDD:275368 | 4/25 (16%) | ||
C2H2 Zn finger | 264..285 | CDD:275368 | 4/20 (20%) | ||
C2H2 Zn finger | 293..313 | CDD:275368 | 4/19 (21%) | ||
zf-C2H2_8 | 305..373 | CDD:292531 | 28/69 (41%) | ||
C2H2 Zn finger | 324..344 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 354..374 | CDD:275368 | 6/21 (29%) | ||
zf-H2C2_2 | 366..389 | CDD:290200 | 8/25 (32%) | ||
C2H2 Zn finger | 382..403 | CDD:275368 | 4/22 (18%) | ||
let-391 | NP_491744.3 | C2H2 Zn finger | 59..79 | CDD:275368 | |
zf-H2C2_2 | 73..96 | CDD:290200 | |||
C2H2 Zn finger | 87..108 | CDD:275368 | |||
C2H2 Zn finger | 116..137 | CDD:275368 | |||
C2H2 Zn finger | 270..290 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 286..304 | CDD:290200 | 13/20 (65%) | ||
C2H2 Zn finger | 298..319 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 327..347 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 357..377 | CDD:275368 | 4/19 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24409 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |