DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and let-391

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_491744.3 Gene:let-391 / 182953 WormBaseID:WBGene00006492 Length:453 Species:Caenorhabditis elegans


Alignment Length:206 Identity:55/206 - (26%)
Similarity:86/206 - (41%) Gaps:19/206 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 PRQDNVKPKERKASGAVHPRSLHPC-PECEKKFTRNFQ----LKLHMTAVHGMGEMRYQCEECRK 269
            |...:..|.:.::|.....:|::|. .|.||....|.:    :...:..|....:.....||..|
 Worm   188 PSTSSSSPSQFQSSNQTTKQSIYPSEKEMEKAAISNARIDDVINTVLARVLAPIDEEIPIEEPEK 252

  Fly   270 NFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTK 334
                ....|.::.:..:|...  |..|.......:::..|:|||||| ||  |||..|..|....
 Worm   253 ----APQKRAYISNRRATLAQ--CNICGLMLKHPSKIADHIRTHTGE-KP--FECGECGLSLSKA 308

  Fly   335 SDLRTHMRSHNPNMERPFKCD-RCSKAFFTRGHLNSH-LLVHTGEKPFAC--EYCDKCYQSVGNL 395
            |.|:.|:|..:.. ||||:|. ||..:|.|......| :.||||.|.:.|  :.|:..:.....|
 Worm   309 SSLKVHIRRMHTG-ERPFECTWRCGLSFVTDSVRKEHEMTVHTGIKRYTCVVKGCNAVFARRVYL 372

  Fly   396 NNHMVRLHADI 406
            ..|....|.::
 Worm   373 MRHRKNAHPEL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 4/25 (16%)
C2H2 Zn finger 264..285 CDD:275368 4/20 (20%)
C2H2 Zn finger 293..313 CDD:275368 4/19 (21%)
zf-C2H2_8 305..373 CDD:292531 28/69 (41%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 354..374 CDD:275368 6/21 (29%)
zf-H2C2_2 366..389 CDD:290200 8/25 (32%)
C2H2 Zn finger 382..403 CDD:275368 4/22 (18%)
let-391NP_491744.3 C2H2 Zn finger 59..79 CDD:275368
zf-H2C2_2 73..96 CDD:290200
C2H2 Zn finger 87..108 CDD:275368
C2H2 Zn finger 116..137 CDD:275368
C2H2 Zn finger 270..290 CDD:275368 4/19 (21%)
zf-H2C2_2 286..304 CDD:290200 13/20 (65%)
C2H2 Zn finger 298..319 CDD:275368 7/20 (35%)
C2H2 Zn finger 327..347 CDD:275368 6/19 (32%)
C2H2 Zn finger 357..377 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.