DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and unc-98

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_509284.2 Gene:unc-98 / 181020 WormBaseID:WBGene00006827 Length:310 Species:Caenorhabditis elegans


Alignment Length:282 Identity:69/282 - (24%)
Similarity:108/282 - (38%) Gaps:46/282 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 ETVDFESL----DFQDSSHSEHDIPSYWESSVDSGSLNTPHHQPETAELFAVEPPT--------- 187
            |..|||.|    |....|...:::....|:...:|..:...::.:..|:..|..||         
 Worm    12 ERDDFEELMNACDLAKMSVKNNEMVHGLETFGINGESSENGNKEKPKEIMKVVAPTVEAYVGSSS 76

  Fly   188 --PPESSEEPAPDAAEKPKMRRARPRQDNVKPKERKASGAVHPRSLHPCPECEKKFTRNFQLKLH 250
              .|..|...|.|.:::.::     |||... .::..:|.|    .:.|..|...|.....|:.|
 Worm    77 AQTPTKSSGGALDGSDQQEV-----RQDGTS-VQKDDNGFV----FYKCRFCGLTFNFMNTLRAH 131

  Fly   251 MTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTG 315
             ..:|.:.: .|.|.:|..:|.....|.||. :.||....:.|: |.|.|...|::|.|  .||.
 Worm   132 -ERIHDVSQ-PYVCGKCGDSFEFACQLEYHA-AQHSEIDGYKCE-CGRTFFSYTEMLYH--KHTD 190

  Fly   316 EAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSH-LLVHTG--E 377
            :....|        ..|..:.::...:...|..|:    |....||.|.|:...| |.|:..  .
 Worm   191 DPLELI--------GAPETTTIKVSKKRVLPVSEQ----DLPQPAFVTEGYEPKHPLRVYNDVRS 243

  Fly   378 KPFACEYCDKCYQSVGNLNNHM 399
            ||:.||||.|.|.....|..||
 Worm   244 KPYICEYCSKSYSDSRGLAYHM 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 5/20 (25%)
C2H2 Zn finger 264..285 CDD:275368 6/20 (30%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
zf-C2H2_8 305..373 CDD:292531 15/68 (22%)
C2H2 Zn finger 324..344 CDD:275368 1/19 (5%)
C2H2 Zn finger 354..374 CDD:275368 7/20 (35%)
zf-H2C2_2 366..389 CDD:290200 10/25 (40%)
C2H2 Zn finger 382..403 CDD:275368 9/18 (50%)
unc-98NP_509284.2 C2H2 Zn finger 115..135 CDD:275368 5/20 (25%)
C2H2 Zn finger 143..163 CDD:275368 6/20 (30%)
SFP1 <169..268 CDD:227516 32/112 (29%)
C2H2 Zn finger 171..189 CDD:275368 7/20 (35%)
C2H2 Zn finger 248..268 CDD:275368 9/18 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.