Sequence 1: | NP_610211.1 | Gene: | CG30431 / 35549 | FlyBaseID: | FBgn0050431 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_499640.1 | Gene: | Y111B2A.10 / 176678 | WormBaseID: | WBGene00013734 | Length: | 430 | Species: | Caenorhabditis elegans |
Alignment Length: | 379 | Identity: | 77/379 - (20%) |
---|---|---|---|
Similarity: | 130/379 - (34%) | Gaps: | 105/379 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 125 SKPVAHVAPLMETVDFESLDFQDSSHSEHDIPSYWESSVDSGSLNTPHHQPETAELF--AVEPPT 187
Fly 188 PPESSEEPAPDAAEKPKMRRARPRQDNVKPKERKASGAVHPR---SLHPCPECEKKFTRNFQLKL 249
Fly 250 HMTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHL---- 310
Fly 311 --------------------------RTHTGEAKPR--IFE------------------------ 323
Fly 324 ---------------------CQRCSKSWPTKSDLRTHM-RSH-----NPNM-----------ER 350
Fly 351 PFKCDRCSKAFFTRGHLNSH-LLVHTGEKPFACEYCDKCYQSVGNLNNHMVRLH 403 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30431 | NP_610211.1 | zf-AD | 11..82 | CDD:285071 | |
C2H2 Zn finger | 234..255 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 264..285 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 293..313 | CDD:275368 | 6/49 (12%) | ||
zf-C2H2_8 | 305..373 | CDD:292531 | 26/162 (16%) | ||
C2H2 Zn finger | 324..344 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 354..374 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 366..389 | CDD:290200 | 8/23 (35%) | ||
C2H2 Zn finger | 382..403 | CDD:275368 | 7/20 (35%) | ||
Y111B2A.10 | NP_499640.1 | C2H2 Zn finger | 148..169 | CDD:275368 | 6/20 (30%) |
zf-C2H2_8 | 151..221 | CDD:292531 | 19/72 (26%) | ||
C2H2 Zn finger | 178..198 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 204..224 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 312..333 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 359..380 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 388..409 | CDD:275368 | 7/20 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24409 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |