DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and szy-5

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_491745.2 Gene:szy-5 / 172281 WormBaseID:WBGene00016154 Length:603 Species:Caenorhabditis elegans


Alignment Length:561 Identity:107/561 - (19%)
Similarity:196/561 - (34%) Gaps:187/561 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LSLLPHHPLVCRCC------------LLEQPP--LYHSLYDASSQLAVELKALAPALRLEH---- 48
            :.:||..|   .|.            :.::||  :||.:     |....:|  .|:...||    
 Worm    39 VEILPSRP---ECLYRRNDPTNRSYRMKKRPPAQIYHCV-----QCNKHIK--YPSKITEHIRKH 93

  Fly    49 -GD--NLTDVICDLCLRRLH--------DARDFQRRC--------------EHSEQVLRMRHEHW 88
             |:  |:.. ||::...:.|        .|.:...:|              ||.||  .|.|.:.
 Worm    94 TGEKPNVCS-ICNISFSQAHTLKTHMQQHAHEKPYKCSFCTAEFLNVYEKNEHEEQ--HMHHPNH 155

  Fly    89 KHTVAVGDALALDDVLECLEREVGSLEGPMSVPLQASKPVAHVAPLM-----ETVDFESLDFQDS 148
            ..|:...:|..                   |..:|.::|.....|..     |...|:|  ::::
 Worm   156 GETMEENNATT-------------------SQFIQVAEPTIQAEPCQIYECSEMCGFQS--YEEA 199

  Fly   149 SHSEHDIPSYWESSVDSG-SLNTPHHQPET-----AELFAVEPPTPPESSE-------------- 193
            ...||...::::.:|.:| .|...:.:||.     .|.:..:.||..|.:.              
 Worm   200 EVVEHMTVTHYQQTVQNGLILQDFNGEPEPIYEFYEEQYVQQVPTEIEETPTIKQQSIPYENLHF 264

  Fly   194 ---EPAP-----------------DAAEKPKMRRARPRQDNVKPKERKASGAVHPRS-------- 230
               |.||                 |..|...:...:..::.::..:....|.:....        
 Worm   265 EHVEAAPGPSEPHLQVVAEGEILYDGEEIVDISNGKSLKEEIQNGDANIYGMIQDLEEEVEDIGN 329

  Fly   231 -----------LHPCPECEKKFTRNFQLKLHMTAVHGMGEM------------------RYQCEE 266
                       ::|.|  .|:.|::  |:.|..|.....||                  .|....
 Worm   330 EDEERERVRIMVNPNP--PKRGTKS--LRDHHEATAATMEMIVDASILELAEPSRHLKQGYPPIS 390

  Fly   267 CRKNFASR-HSLRYHVKSV-----------HSTERP--FGCQHCDRRFILRTQLLSHLRTHTGEA 317
            .|||...| .:|.:.:.:|           |..::|  ..|::|.|.....:::.:|:|||||| 
 Worm   391 KRKNTGKRAENLDWIIDAVAKGVDVSEASPHHRKKPTLHKCEYCGRVDKYPSKIRAHMRTHTGE- 454

  Fly   318 KPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKC--DRCSKAFFTRGHLNSHL-LVHTGEKP 379
            ||  |:|:.|..::..|:.:|.|:|.|..  ::|::|  |.|.:.|.:...|..|: ..|..:|.
 Worm   455 KP--FKCEICGMAFSQKTPMRLHLRRHFD--QKPYECDVDGCKERFVSGAILKMHVEKKHLNKKK 515

  Fly   380 FACEY-CDKCYQSVGNLNNHMVRLHADIIE-AQLEAEGIES 418
            :.|.. |.:.:.|..|..:|..:.....:. .:.|.:.:||
 Worm   516 YVCSRGCGRVFSSAYNQKHHEKKCEQTYVTWVEGEQQSVES 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 21/113 (19%)
C2H2 Zn finger 234..255 CDD:275368 6/20 (30%)
C2H2 Zn finger 264..285 CDD:275368 6/32 (19%)
C2H2 Zn finger 293..313 CDD:275368 5/19 (26%)
zf-C2H2_8 305..373 CDD:292531 24/70 (34%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 6/22 (27%)
zf-H2C2_2 366..389 CDD:290200 6/24 (25%)
C2H2 Zn finger 382..403 CDD:275368 5/21 (24%)
szy-5NP_491745.2 C2H2 Zn finger 73..93 CDD:275368 5/26 (19%)
C2H2 Zn finger 101..121 CDD:275368 3/20 (15%)
C2H2 Zn finger 129..149 CDD:275368 5/21 (24%)
C2H2 Zn finger 431..451 CDD:275368 5/19 (26%)
zf-H2C2_2 445..468 CDD:372612 12/25 (48%)
C2H2 Zn finger 459..479 CDD:275368 6/19 (32%)
C2H2 Zn finger 487..506 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.