DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and ZNF664

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001191227.1 Gene:ZNF664 / 144348 HGNCID:25406 Length:261 Species:Homo sapiens


Alignment Length:172 Identity:64/172 - (37%)
Similarity:91/172 - (52%) Gaps:9/172 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 HPCPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTERPFGCQHC 296
            |.|.:|:|.|....:|.:|..  ...||..|:|::|.|:|::...|..| |.:|:.|:|:.|..|
Human    31 HKCDKCDKGFFHISELHIHWR--DHTGEKVYKCDDCGKDFSTTTKLNRH-KKIHTVEKPYKCYEC 92

  Fly   297 DRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAF 361
            .:.|...:.|..|:|.|||| ||  :.|..|.:.:...|:|..|.|.|..  |:||||:.|.|||
Human    93 GKAFNWSSHLQIHMRVHTGE-KP--YVCSECGRGFSNSSNLCMHQRVHTG--EKPFKCEECGKAF 152

  Fly   362 FTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMVRLH 403
            .....|..|..|||||||:.|..|.|.:....:|..|. |:|
Human   153 RHTSSLCMHQRVHTGEKPYKCYECGKAFSQSSSLCIHQ-RVH 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 6/20 (30%)
C2H2 Zn finger 264..285 CDD:275368 7/20 (35%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
zf-C2H2_8 305..373 CDD:292531 27/67 (40%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 7/19 (37%)
zf-H2C2_2 366..389 CDD:290200 12/22 (55%)
C2H2 Zn finger 382..403 CDD:275368 6/20 (30%)
ZNF664NP_001191227.1 C2H2 Zn finger 5..25 CDD:275368
C2H2 Zn finger 33..53 CDD:275368 6/21 (29%)
C2H2 Zn finger 61..81 CDD:275368 7/20 (35%)
zf-H2C2_2 74..97 CDD:404364 8/23 (35%)
C2H2 Zn finger 89..109 CDD:275368 6/19 (32%)
COG5048 <94..256 CDD:227381 42/106 (40%)
C2H2 Zn finger 117..137 CDD:275368 6/19 (32%)
C2H2 Zn finger 145..165 CDD:275368 7/19 (37%)
C2H2 Zn finger 173..193 CDD:275368 6/20 (30%)
C2H2 Zn finger 201..221 CDD:275368
C2H2 Zn finger 229..249 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7426
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.