| Sequence 1: | NP_610211.1 | Gene: | CG30431 / 35549 | FlyBaseID: | FBgn0050431 | Length: | 418 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009289663.1 | Gene: | si:dkey-77f5.4 / 100147955 | ZFINID: | ZDB-GENE-131121-70 | Length: | 456 | Species: | Danio rerio |
| Alignment Length: | 229 | Identity: | 83/229 - (36%) |
|---|---|---|---|
| Similarity: | 116/229 - (50%) | Gaps: | 39/229 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 220 RKASGAVHPR-----SLHPCPECEKKFTRNFQLKLHM---------------------------T 252
Fly 253 AVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEA 317
Fly 318 KPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFAC 382
Fly 383 EYCDKCYQSVGNLNNHMVRLHADIIEAQLEAEGI 416 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG30431 | NP_610211.1 | zf-AD | 11..82 | CDD:285071 | |
| C2H2 Zn finger | 234..255 | CDD:275368 | 12/47 (26%) | ||
| C2H2 Zn finger | 264..285 | CDD:275368 | 9/20 (45%) | ||
| C2H2 Zn finger | 293..313 | CDD:275368 | 8/19 (42%) | ||
| zf-C2H2_8 | 305..373 | CDD:292531 | 31/67 (46%) | ||
| C2H2 Zn finger | 324..344 | CDD:275368 | 10/19 (53%) | ||
| C2H2 Zn finger | 354..374 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 366..389 | CDD:290200 | 10/22 (45%) | ||
| C2H2 Zn finger | 382..403 | CDD:275368 | 6/20 (30%) | ||
| si:dkey-77f5.4 | XP_009289663.1 | COG5048 | 82..441 | CDD:227381 | 83/229 (36%) |
| C2H2 Zn finger | 94..114 | CDD:275368 | |||
| zf-H2C2_2 | 106..131 | CDD:290200 | |||
| C2H2 Zn finger | 122..142 | CDD:275368 | |||
| C2H2 Zn finger | 150..170 | CDD:275368 | |||
| zf-H2C2_2 | 162..187 | CDD:290200 | 83/229 (36%) | ||
| CpXC | 177..>222 | CDD:291051 | 14/34 (41%) | ||
| C2H2 Zn finger | 178..198 | CDD:275368 | 4/10 (40%) | ||
| C2H2 Zn finger | 206..226 | CDD:275368 | 11/19 (58%) | ||
| SIR2 | <221..>273 | CDD:294129 | 10/52 (19%) | ||
| C2H2 Zn finger | 234..254 | CDD:275368 | 1/19 (5%) | ||
| zf-H2C2_2 | 246..271 | CDD:290200 | 8/25 (32%) | ||
| C2H2 Zn finger | 262..282 | CDD:275368 | 9/20 (45%) | ||
| C2H2 Zn finger | 290..310 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 302..327 | CDD:290200 | 12/27 (44%) | ||
| C2H2 Zn finger | 318..338 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 330..354 | CDD:290200 | 13/25 (52%) | ||
| C2H2 Zn finger | 346..366 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 358..383 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 374..394 | CDD:275368 | 6/19 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||