DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and RPN8

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_014904.3 Gene:RPN8 / 854435 SGDID:S000005787 Length:338 Species:Saccharomyces cerevisiae


Alignment Length:284 Identity:70/284 - (24%)
Similarity:133/284 - (46%) Gaps:28/284 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KVYLKPLVFFQIIDAYDR-RPKGDNQVMGTLLGRNKEGHIEITNCFTVPHKEHSENKRI-DLDMA 73
            ||.:.|||....:|.|:| :.|.:.:.:|.:||......|.:||.|.:|.:|..:|..: .||..
Yeast     7 KVTIAPLVLLSALDHYERTQTKENKRCVGVILGDANSSTIRVTNSFALPFEEDEKNSDVWFLDHN 71

  Fly    74 YASEVLELNMFAYPNERVLGWFCTGKSVSRSASLIHDYYVRECCEGQPLHLLVDAALKNQRLSTR 138
            |...:.|:.......|:::||:.:|..:..|...|::.: ::..:..||.|:||...:...|.|.
Yeast    72 YIENMNEMCKKINAKEKLIGWYHSGPKLRASDLKINELF-KKYTQNNPLLLIVDVKQQGVGLPTD 135

  Fly   139 LYCAVEMGVPGGTK-GLMFSLVPLEISNENSDLVALRCIEKQSQQQASKQMERFVPELAQVVDAT 202
            .|.|:|.....||. ...|..:|..|..|.::.:.:..:.:..:.||:..:.   ..|...:.:.
Yeast   136 AYVAIEQVKDDGTSTEKTFLHLPCTIEAEEAEEIGVEHLLRDVRDQAAGGLS---IRLTNQLKSL 197

  Fly   203 RDMQHRLDLVLRYINDVLARKKKPDN--VVGRSLYAALTAVPLL---DSDKF------RVMFNTN 256
            :.:|.:|..|:.|::.|: .|:.|.|  ::|: |......:|.|   |.|:.      |:..:.|
Yeast   198 KGLQSKLKDVVEYLDKVI-NKELPINHTILGK-LQDVFNLLPNLGTPDDDEIDVENHDRINISNN 260

  Fly   257 LR--------DMLMAITLSTMIKT 272
            |:        |.||.|.:|.::::
Yeast   261 LQKALTVKTNDELMVIYISNLVRS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 69/283 (24%)
RPN8NP_014904.3 MPN_RPN7_8 6..303 CDD:163693 70/284 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343886
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.