DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and RPN11

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_116659.1 Gene:RPN11 / 850554 SGDID:S000001900 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:264 Identity:46/264 - (17%)
Similarity:99/264 - (37%) Gaps:71/264 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QVMGTLLGRNKEGH-IEITNCFTVPHKEHSENKRIDLDMAYASEVLELNMFAYPNERVLGWF--- 95
            :|||.:||...:.: :.:.:.|.:|......:... :|..:.::::::......::.|:||:   
Yeast    48 EVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEA-VDDVFQAKMMDMLKQTGRDQMVVGWYHSH 111

  Fly    96 ----CTGKSV------------SRSASLIHDYYVRECCEGQPLH-----LLVDA-------ALKN 132
                |...||            ||:.:::.|          |:.     :::||       ||.|
Yeast   112 PGFGCWLSSVDVNTQKSFEQLNSRAVAVVVD----------PIQSVKGKVVIDAFRLIDTGALIN 166

  Fly   133 Q---RLST-------------------RLYCAVEMGVPGGTKGLMFSLVPLEISNENSDLVALRC 175
            .   |.:|                   |.|.::.:......|.... |:.|......|.|.....
Yeast   167 NLEPRQTTSNTGLLNKANIQALIHGLNRHYYSLNIDYHKTAKETKM-LMNLHKEQWQSGLKMYDY 230

  Fly   176 IEK-QSQQQASKQMERFVPELAQVVDATRDMQHRLDLVLRYINDVLARK---KKPDNVVGRSLYA 236
            .|| :|...|:|.|.:...:.::.::..:::... :|..||:.....:|   :..|..:..::.:
Yeast   231 EEKEESNLAATKSMVKIAEQYSKRIEEEKELTEE-ELKTRYVGRQDPKKHLSETADETLENNIVS 294

  Fly   237 ALTA 240
            .|||
Yeast   295 VLTA 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 46/264 (17%)
RPN11NP_116659.1 MPN_RPN11_CSN5 22..282 CDD:163700 42/246 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.