DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and AT5G23540

DIOPT Version :10

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_197745.1 Gene:AT5G23540 / 832420 AraportID:AT5G23540 Length:308 Species:Arabidopsis thaliana


Alignment Length:86 Identity:17/86 - (19%)
Similarity:39/86 - (45%) Gaps:4/86 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KVYLKPLVFFQIIDAYDRRPKGDNQVMGTLLGRNKEGH-IEITNCFTVPHKEHSENKRIDLDMAY 74
            :||:..|...:::.  ..|.....:|||.:||...:.: :.:.:.|.:|......:... :|..:
plant    29 QVYISSLALLKMLK--HGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEA-VDHVF 90

  Fly    75 ASEVLELNMFAYPNERVLGWF 95
            .:.:|::.......|.|:||:
plant    91 QTNMLDMLKQTGRPEMVVGWY 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 17/85 (20%)
AT5G23540NP_197745.1 MPN_RPN11_CSN5 19..285 CDD:163700 17/86 (20%)

Return to query results.
Submit another query.