DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and MEE34

DIOPT Version :10

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_187736.1 Gene:MEE34 / 820298 AraportID:AT3G11270 Length:310 Species:Arabidopsis thaliana


Alignment Length:30 Identity:8/30 - (26%)
Similarity:14/30 - (46%) Gaps:0/30 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DIQNDMETLQKLHHILLEVDVVEGTLECPE 101
            :::.|.....:|.|.:....:..|.|.|||
plant    69 ELEEDHREGMRLTHSMEPDGMACGLLGCPE 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 8/30 (27%)
MEE34NP_187736.1 PLN03246 10..310 CDD:215645 8/30 (27%)

Return to query results.
Submit another query.