DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and BRCC3

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_005274808.1 Gene:BRCC3 / 79184 HGNCID:24185 Length:317 Species:Homo sapiens


Alignment Length:245 Identity:41/245 - (16%)
Similarity:80/245 - (32%) Gaps:98/245 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 RVLGWFCTGKSVSRSASLIHDYYVRECCEGQPLHLLVDAALKNQRLSTRLYCAVEMGVPGGTKGL 154
            ||:||:.:...::...|.:.   ||.    |.::.::|.                     |..||
Human   117 RVVGWYHSHPHITVWPSHVD---VRT----QAMYQMMDQ---------------------GFVGL 153

  Fly   155 MFSLVPLEISNENSDLVALRCIEKQSQQQASKQMERFVPELAQVVDATRDM----QH-------- 207
            :||.. :|..|..:..|...|.:....|::|:.:.           ..||.    ||        
Human   154 IFSCF-IEDKNTKTGRVLYTCFQSIQAQKSSESLH-----------GPRDFWSSSQHISIEGQKE 206

  Fly   208 -----RLDLVLRYINDVLARKKKPDNVVGRSLYAALTAVPLL----DSDKFR------------- 250
                 |:::.:..:         |...:|:....:...:|.:    :.|.:|             
Human   207 EERYERIEIPIHIV---------PHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTK 262

  Fly   251 ----VMFNTNLRDMLMAIT--LSTMIKTQLEIS---------EKLSCMQD 285
                .:|..||...:.|::  |...::.:||.:         ||...||:
Human   263 IHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 38/238 (16%)
BRCC3XP_005274808.1 MPN_BRCC36 13..293 CDD:163699 35/224 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.