DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and Mpnd

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_038940132.1 Gene:Mpnd / 681944 RGDID:1589335 Length:488 Species:Rattus norvegicus


Alignment Length:232 Identity:45/232 - (19%)
Similarity:72/232 - (31%) Gaps:69/232 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RNKEGHIEITNCFTVPHKEHSENKRIDLDMAYASEVLELNMF----------------------- 84
            ||....:|:|:...:       ||....::|.:|.||.|..|                       
  Rat   236 RNPHTLVEVTSFAAI-------NKFQPFNVAVSSNVLFLLDFHCHLTRSEVVGYLGGRWDINNQM 293

  Fly    85 -----AYPNERVLGWFCTGKSVS---------RSASLIHDYYVRECCEGQPLHLLVDAALKNQRL 135
                 |:|....||...|..:|.         |..||:..|:........|....:||.::.|  
  Rat   294 LTVLRAFPCRSRLGDPDTAATVEEEIHQVLFLRGLSLVGWYHSHPHSPAAPSLQDIDAQMEYQ-- 356

  Fly   136 STRLYCAVEMGVPGGTKGLMFSLV----PLEISN--ENSDLVALRCIEKQSQQQASKQMERFVPE 194
                     :.:.|...|....|.    |....|  ..|.:.....:....||:.|........|
  Rat   357 ---------LRLQGSNNGFQPCLALLCSPYYSGNPGPESKICPFWVMPPPEQQRPSDYGIPMDVE 412

  Fly   195 LAQVVDA--TRDMQHRLDLVLRYINDVLARKKKPDNV 229
            :|.|.|:  |.|:...:.:::.:.      |..||.|
  Rat   413 MAYVQDSFLTNDVLQEMMMLVEFY------KGAPDLV 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 45/232 (19%)
MpndXP_038940132.1 RAMA 57..157 CDD:408526
MPN_2A_DUB 252..437 CDD:163698 36/201 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.