powered by:
Protein Alignment eIF3f2 and stambpb
DIOPT Version :9
Sequence 1: | NP_610210.2 |
Gene: | eIF3f2 / 35547 |
FlyBaseID: | FBgn0033069 |
Length: | 286 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001032659.1 |
Gene: | stambpb / 641572 |
ZFINID: | ZDB-GENE-051127-31 |
Length: | 418 |
Species: | Danio rerio |
Alignment Length: | 51 |
Identity: | 13/51 - (25%) |
Similarity: | 23/51 - (45%) |
Gaps: | 9/51 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 127 DAALKNQRLSTRLYCAVEMGVPGGTKGLMFSLVPLEISNENSDLVALRCIE 177
|.:||...|:|.:....::.||....|.. |.::|.|: :|.:|
Zfish 233 DRSLKPSHLTTLIDGLRQIAVPAELCGKF-----LRLANNNT----IRAVE 274
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1310 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.