DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and STAMBPL1

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_065850.1 Gene:STAMBPL1 / 57559 HGNCID:24105 Length:436 Species:Homo sapiens


Alignment Length:290 Identity:55/290 - (18%)
Similarity:96/290 - (33%) Gaps:86/290 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMSRNFSMRAKVYLKPLVFFQIIDA--------------------YDRRPKGDNQVMGTLLGRNK 45
            :.|:| ..:|:: ||.|...::|:|                    ::.:.|......|.:..:..
Human   137 LQSKN-KYKAEI-LKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQT 199

  Fly    46 EGHIE-----ITNCFTV-------------PHKEHSENKRIDLDMAYASEVLELN--------MF 84
            .|..|     ..:||:.             |:|..:.|        |||....:|        :.
Human   200 SGLSEQIDGSALSCFSTHQNNSLLNVFADQPNKSDATN--------YASHSPPVNRALTPAATLS 256

  Fly    85 AYPNERVLGWFCTGKSVSRSASLIHDYYVRECCEGQPLHLLVDAALKNQRLSTRLYCAVEMGVPG 149
            |..|..|.|..|    |.....|.|.:.  :..|...:..:....:...:|:...:....:.||.
Human   257 AVQNLVVEGLRC----VVLPEDLCHKFL--QLAESNTVRGIETCGILCGKLTHNEFTITHVIVPK 315

  Fly   150 GTKGL----MFSLVPLEISNENSDLVALRCIEKQSQQQA-----------SKQMERFVPELAQVV 199
            .:.|.    |.::..|....:..||:.|..|.....|.|           |.|:  .:||...:|
Human   316 QSAGPDYCDMENVEELFNVQDQHDLLTLGWIHTHPTQTAFLSSVDLHTHCSYQL--MLPEAIAIV 378

  Fly   200 DATRDMQHRLDLVLRYIN----DVLARKKK 225
            .:.:   |:...:.|..|    :|.|.|||
Human   379 CSPK---HKDTGIFRLTNAGMLEVSACKKK 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 52/279 (19%)
STAMBPL1NP_065850.1 USP8_dimer 28..129 CDD:286108
GBP_C <120..198 CDD:303769 10/62 (16%)
MPN_AMSH_like 266..436 CDD:163697 30/151 (20%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 347..360 2/12 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.