DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and PSMD7

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_002802.2 Gene:PSMD7 / 5713 HGNCID:9565 Length:324 Species:Homo sapiens


Alignment Length:272 Identity:66/272 - (24%)
Similarity:122/272 - (44%) Gaps:21/272 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KVYLKPLVFFQIIDAYDRRPKGDNQ--VMGTLLGRNKEGHIEITNCFTVPHKEHSENKRI-DLDM 72
            ||.:.|||...::|.::|..|..||  |:|.|||..::..::::|.|.||..|..::..: .||.
Human     8 KVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDH 72

  Fly    73 AYASEVLELNMFAYPN--ERVLGWFCTGKSVSRSASLIHDYYVRECCEGQPLHLLVDAALKNQRL 135
            .|...:  ..||...|  ||::||:.||..:.::...|::...|.|  ...:.:::|...|:..|
Human    73 DYLENM--YGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYC--PNSVLVIIDVKPKDLGL 133

  Fly   136 STRLYCAVEMGVPGGT-KGLMFSLVPLEISNENSDLVA----LRCIEKQSQQQASKQMERFVPEL 195
            .|..|.:||.....|| ....|..|..||..|.::.|.    ||.|:..:....|::       :
Human   134 PTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQR-------I 191

  Fly   196 AQVVDATRDMQHRLDLVLRYINDVLARKKKPDNVVGRSLYAALTAVPLLDSDKFRVMFNTNLRDM 260
            ...|...:.:..:|..:..|:..|...|...::.:...|......:|.:...:|...|.....|.
Human   192 TNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQ 256

  Fly   261 LMAITLSTMIKT 272
            ::.:.|:::|::
Human   257 MVVVYLASLIRS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 65/271 (24%)
PSMD7NP_002802.2 MPN_RPN7_8 7..285 CDD:163693 66/272 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D455272at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.