DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and stambpl1

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_009304952.1 Gene:stambpl1 / 570542 ZFINID:ZDB-GENE-100215-4 Length:466 Species:Danio rerio


Alignment Length:216 Identity:42/216 - (19%)
Similarity:68/216 - (31%) Gaps:66/216 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DRRPKGDNQVMGTLLGRNKEGHIEITNCFTVPHKEHS--------------ENKRID-------- 69
            |..||...|..|:.|.:....|:.:.     |::...              :|:|::        
Zfish   197 DAGPKVPEQTDGSCLSQTPRNHVRLD-----PNRNKPAAPIPKPAATLAAVQNQRVEGLRRVLIP 256

  Fly    70 LDMAYASEVLELNMFAYPNERVLGWFCTGKSVSRSASLIH----------DY----YVRECCEGQ 120
            .|:.|...:|..:..|...| ..|..| ||.......|.|          ||    .|.|....|
Zfish   257 RDLTYRFLLLADSNTARGIE-TCGVLC-GKLTHNEFVLTHVIVPKQSAGPDYCDMENVEELFSYQ 319

  Fly   121 PLH-LLVDAALKNQRLSTRLYCAVEMGVPGGTKGLMFSLVPLEISNENSDLVALRCIEKQSQ--- 181
            ..| ||....:......|....:|::    .|......::|        :.:|:.|..|.::   
Zfish   320 DHHNLLTLGWIHTHPTQTAFLSSVDL----HTHSSYQLMLP--------EAIAIVCAPKHNESFP 372

  Fly   182 -------QQASKQMERFVPEL 195
                   :....|:|||.|.|
Zfish   373 AHQCWNGRSGRMQIERFSPPL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 42/216 (19%)
stambpl1XP_009304952.1 USP8_dimer 28..130 CDD:286108
MPN_AMSH_like 250..>369 CDD:163697 26/132 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.