DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and mysm1

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_021324132.1 Gene:mysm1 / 561225 ZFINID:ZDB-GENE-041014-28 Length:828 Species:Danio rerio


Alignment Length:254 Identity:49/254 - (19%)
Similarity:84/254 - (33%) Gaps:75/254 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QVMGTLLGRNKEGHIEITNCFTVPHKEHSENKRIDLD---MAYASEVLELNMFAYPNERVLGWFC 96
            :|:|.|.|..:|....:..|...|....|...:.::|   ...|||||.:...:     |:||:.
Zfish   543 EVIGLLGGTYEEEDKVLKICSAEPCNSLSTGLQCEMDPVSQTQASEVLGVKGLS-----VVGWYH 602

  Fly    97 TGKSVSRSASLIHDYYVRECCEGQPLHLLVDAALKNQRLSTRLYCAVEMGVPGGTKGLMFSLVPL 161
            :..:...:.||      |:          :|...|.|...:|          ||...:...:.|.
Zfish   603 SHPAFDPNPSL------RD----------IDTQAKYQSYFSR----------GGAPFIGMIVSPY 641

  Fly   162 EISNENSDLVALRCIEKQSQ----------QQASKQMERFVPELAQVV---------------DA 201
            ..|| :|......|:..|.:          .|.:.|.....|:.::|:               ..
Zfish   642 NPSN-SSPQSQSTCLLVQEEPGPSGSHKFPYQFNMQCSAEPPDWSEVMRRAEWVVFKYRLCHGSV 705

  Fly   202 TRDMQHRLDLVLRYINDVLARKKKPDNVVGRSLYAALTAVPLLDSDKFRV----MFNTN 256
            ..|...|.|..|..:..:|.           |:...|..:..:|.:.|.|    :|||:
Zfish   706 PMDRLFRRDSSLTCLEKMLL-----------SIRTVLERLSEVDIETFLVQLESLFNTH 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 49/254 (19%)
mysm1XP_021324132.1 SANT 107..150 CDD:238096
SWIRM 331..408 CDD:309539
MPN_2A_DUB 517..699 CDD:163698 36/187 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.