DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and eif3f

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001186938.1 Gene:eif3f / 557270 ZFINID:ZDB-GENE-100215-2 Length:273 Species:Danio rerio


Alignment Length:269 Identity:100/269 - (37%)
Similarity:160/269 - (59%) Gaps:6/269 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VYLKPLVFFQIIDAYDRRPKGDNQVMGTLLGRNKEGHIEITNCFTVPHKEHSENKRIDLDMAYAS 76
            |.:.|:|...|:|:|:||.:|.::|:|||||...:..:::||||:|||.| ||:: :.:||.:|.
Zfish     8 VKIHPVVLASIVDSYERRNEGASRVIGTLLGTADKHSVDVTNCFSVPHNE-SEDE-VAVDMEFAK 70

  Fly    77 EVLELNMFAYPNERVLGWFCTGKSVSRSASLIHDYYVRECCEGQPLHLLVDAALKNQRLSTRLYC 141
            .:.||:....|:|.::||:.||..::..:.|||:||.||.  ..|:||.||.||::.:::.|.|.
Zfish    71 NMYELHKKVSPSEVIVGWYATGFDITEHSVLIHEYYSREA--PNPIHLTVDTALQSNKMNIRAYV 133

  Fly   142 AVEMGVPGGTKGLMFSLVPLEISNENSDLVALRCIEKQSQQQASKQMERFVPELAQVVDATRDMQ 206
            :.:|||||.|.|:||:  ||.:.....|...:.....|..:.:..:......:||||..|...:|
Zfish   134 SSQMGVPGKTVGVMFT--PLSVKYIYYDTERIGVDLLQRTRASPGRTNGLTTDLAQVAGAAGRVQ 196

  Fly   207 HRLDLVLRYINDVLARKKKPDNVVGRSLYAALTAVPLLDSDKFRVMFNTNLRDMLMAITLSTMIK 271
            ..|..||.||.|||:.|...||.|||.|...:..||.:.::.|..|.|:|:.|:||...|:.:.:
Zfish   197 EMLATVLSYIEDVLSGKVMADNSVGRFLMDLVNKVPKIPAEDFENMLNSNINDLLMVTYLANLTQ 261

  Fly   272 TQLEISEKL 280
            .|:.::|||
Zfish   262 AQIALNEKL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 98/267 (37%)
eif3fNP_001186938.1 MPN_eIF3f 8..270 CDD:163695 98/267 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580868
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54712
OrthoDB 1 1.010 - - D1038775at2759
OrthoFinder 1 1.000 - - FOG0004972
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10540
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3506
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.