DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and CG2224

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001263108.1 Gene:CG2224 / 43617 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster


Alignment Length:128 Identity:32/128 - (25%)
Similarity:47/128 - (36%) Gaps:49/128 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PNERVLGWFCTGKSVSRSASLIHDYYVRECCEGQPLHLLVDAALKNQRLSTRLYCAVEMGVPGGT 151
            |.||:       |.:|...:||.                ||   ||..: ||.|       ..||
  Fly    15 PQERM-------KHLSHCGNLIE----------------VD---KNMPV-TRYY-------RSGT 45

  Fly   152 KGLMFSLVPL-EISNENSDLVALR----CIEKQSQQQASKQMERFVPELAQVVDATRDMQHRL 209
            :.|..:.|.| |.::||:.::.||    .|||..|.          |:...|....||:..::
  Fly    46 EMLRMANVYLREGNHENAFILYLRYMTLFIEKIRQH----------PDYGSVKAEVRDINRKI 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 32/128 (25%)
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108 31/127 (24%)
MPN_AMSH_like 247..419 CDD:163697
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.