DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and CSN6

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_524451.1 Gene:CSN6 / 42661 FlyBaseID:FBgn0028837 Length:341 Species:Drosophila melanogaster


Alignment Length:298 Identity:67/298 - (22%)
Similarity:125/298 - (41%) Gaps:56/298 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMSRNFSMRAKVYLKPLVFFQIIDAYDR------RPKGDNQVMGTLLGRNKEGHIEITNCF---- 55
            |.:...|....:.|.|||...|.:.:.|      .|:   ||.|.|:|:.|..:|||.|.|    
  Fly    43 MAAAGTSGSVTISLHPLVIMNISEHWTRFRAQHGEPR---QVYGALIGKQKGRNIEIMNSFELKT 104

  Fly    56 ------TVPHKEHSENKRIDLDMAYASEVLELNMFAYPNERVLGWFCTGKS-------VSRSASL 107
                  ||.:|::...|    :..|.....:|:.        :||:.||.:       :.|..:.
  Fly   105 DVIGDETVINKDYYNKK----EQQYKQVFSDLDF--------IGWYTTGDNPTADDIKIQRQIAA 157

  Fly   108 IHDYYVREC---CEGQPLHLLVDAALKNQRLSTRLYCAVEMGVPGGTKGLMFSLVPLEISNENSD 169
            |:     ||   .:..||...||      .|..:|:.:: :.:..|...::|..:...::.|.::
  Fly   158 IN-----ECPIMLQLNPLSRSVD------HLPLKLFESL-IDLVDGEATMLFVPLTYTLATEEAE 210

  Fly   170 LVALRCIEKQSQQQASKQMERFVPE-LAQVVDATRDMQHRLDLVLRYINDVLARKKKPDNVVGRS 233
            .:.:..:.:.:..::.:  :..|.| |.....|.:.:..|:.:||:||.||.|.|.:.:..:.|.
  Fly   211 RIGVDHVARMTSNESGE--KSVVAEHLVAQDSAIKMLNTRIKIVLQYIRDVEAGKLRANQEILRE 273

  Fly   234 LYAALTAVPLLDSDKFRVMFNTNLRDMLMAITLSTMIK 271
            .||....:|::....|:..|.|...|:.:...|.|:.|
  Fly   274 AYALCHRLPVMQVPAFQEEFYTQCNDVGLISYLGTLTK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 65/287 (23%)
CSN6NP_524451.1 MPN_CSN6 52..335 CDD:163694 65/289 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449353
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10540
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.