DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and eIF3f1

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster


Alignment Length:283 Identity:113/283 - (39%)
Similarity:188/283 - (66%) Gaps:10/283 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMSRNFSMRAKVYLKPLVFFQIIDAYDRRPKGDNQVMGTLLGRNKEGHIEITNCFTVPHKEHSEN 65
            |.:.|.::|    :.|:|.||::||::||....::|:|||||...:|.:|:||||.||||||.: 
  Fly     1 MSALNLTVR----VHPVVLFQVVDAFERRNADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEHDD- 60

  Fly    66 KRIDLDMAYASEVLELNMFAYPNERVLGWFCTGKSVSRSASLIHDYYVRECCEGQPLHLLVDAAL 130
             :::.:::||.::.:||.....||.|:||:.||..|:..:|:||:||.|||  ..|:||.||.:|
  Fly    61 -QVEAELSYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYAREC--NNPVHLTVDTSL 122

  Fly   131 KNQRLSTRLYCAVEMGVPGGTKGLMFSLVPLEISNENSDLVALRCIEKQSQQQASKQMERFVP-- 193
            :..|:..|.|..:::|||||..|.||:.:|:|:::...:...|:.::|......:.:.:...|  
  Fly   123 QGGRMGLRAYVCIQLGVPGGKSGCMFTPIPVELTSYEPETFGLKLLQKTVGVSPAHRPKTVPPML 187

  Fly   194 ELAQVVDATRDMQHRLDLVLRYINDVLARKKKPDNVVGRSLYAALTAVPLLDSDKFRVMFNTNLR 258
            :|||:.:|:..:|..|||:|:|::||:|.|..|||.|||.|...:.:||.:..::|..|||.|:|
  Fly   188 DLAQISEASTKLQSLLDLILKYVDDVIAHKVTPDNAVGRQLLDLIHSVPHMTHEQFTQMFNANVR 252

  Fly   259 DMLMAITLSTMIKTQLEISEKLS 281
            ::|:.||||.:|||||:::|||:
  Fly   253 NLLLVITLSQLIKTQLQLNEKLT 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 108/269 (40%)
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 109/273 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449351
Domainoid 1 1.000 63 1.000 Domainoid score I3721
eggNOG 1 0.900 - - E1_COG1310
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 192 1.000 Inparanoid score I1369
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1038775at2759
OrthoFinder 1 1.000 - - FOG0004972
OrthoInspector 1 1.000 - - otm3208
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10540
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3506
109.900

Return to query results.
Submit another query.