DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and cops5

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_989109.1 Gene:cops5 / 394714 XenbaseID:XB-GENE-952827 Length:334 Species:Xenopus tropicalis


Alignment Length:94 Identity:21/94 - (22%)
Similarity:40/94 - (42%) Gaps:12/94 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RPKGDNQVMGTLLGRNKEGHIEITNCFTVPHKEHSENKRIDLDMA---YASEVLELNMFAYPNER 90
            |..|:.:|||.:||:.....:.|.:.|.:| .|.:|. |::...|   |.:..:|........|.
 Frog    70 RSGGNLEVMGLMLGKVDGETMIIMDSFALP-VEGTET-RVNAQAAAYEYMAAYIENAKQVGRLEN 132

  Fly    91 VLGWF-------CTGKSVSRSASLIHDYY 112
            .:||:       |....:..|..:::..:
 Frog   133 AIGWYHSHPGYGCWLSGIDVSTQMLNQQF 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 21/94 (22%)
cops5NP_989109.1 MPN_RPN11_CSN5 44..314 CDD:163700 21/94 (22%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 138..151 1/12 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.