DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and Rpn8

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster


Alignment Length:297 Identity:81/297 - (27%)
Similarity:142/297 - (47%) Gaps:29/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMSRNFSMRAKVYLKPLVFFQIIDAYDRRPKGDNQ--VMGTLLG--RNKEGHIEITNCFTVPHKE 61
            |.|:..|:. ||.:.|||...::|.::|..|..||  |:|.|||  |:| |.::::|.|.||..|
  Fly     1 MPSQEVSVN-KVIVHPLVLLSVVDHFNRMGKIGNQKRVVGVLLGCWRSK-GVLDVSNSFAVPFDE 63

  Fly    62 HSENKRI-DLDMAYASEVLELNMFAYPN--ERVLGWFCTGKSVSRSASLIHDYYVRECCEGQPLH 123
            ..::|.: .||..|...:  ..||...|  |||:||:.||..:.::...|:: .||..|....| 
  Fly    64 DDKDKSVWFLDHDYLENM--YGMFKKVNARERVVGWYHTGPKLHQNDIAINE-LVRRYCPNSVL- 124

  Fly   124 LLVDAALKNQRLSTRLYCAV-EMGVPGGTKGLMFSLVPLEISNENSDLVA----LRCIEKQSQQQ 183
            :::||..|:..|.|..|.:| |:...|......|..||.||..|.::.|.    ||.|:..:...
  Fly   125 VIIDAKPKDLGLPTEAYISVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGVEHLLRDIKDTTVGS 189

  Fly   184 ASKQMERFVPELAQVVDATRDMQHRLDLVLRYINDVLARKKKPDNVVGRSLYAALTAVPLLDSDK 248
            .|:::...:..|..:....||::       :|:..|...|...::.:...|......:|.:.:|:
  Fly   190 LSQKITNQLMGLKGLNAQLRDIK-------QYLQRVGDSKMPINHQIVYQLQDIFNLLPDITNDQ 247

  Fly   249 FRVMFNTNLRDMLMAITLSTMIKTQLE----ISEKLS 281
            |.........|.::.:.|::|:::.:.    |:.||:
  Fly   248 FTGTMYVKTNDQMLVVYLASMVRSIIALHNLINNKLA 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 75/283 (27%)
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 79/291 (27%)
MPN_RPN7_8 9..290 CDD:163693 78/289 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449356
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D455272at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10540
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.