DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and Rpn11

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster


Alignment Length:86 Identity:17/86 - (19%)
Similarity:41/86 - (47%) Gaps:4/86 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KVYLKPLVFFQIIDAYDRRPKGDNQVMGTLLGRNKEGH-IEITNCFTVPHKEHSENKRIDLDMAY 74
            :||:..|...:::.  ..|.....:|||.:||...:.: :::.:.|.:|......:... :|..:
  Fly    28 QVYISSLALLKMLK--HGRAGVPMEVMGLMLGEFVDDYTVQVIDVFAMPQTGTGVSVEA-VDPVF 89

  Fly    75 ASEVLELNMFAYPNERVLGWF 95
            .:::|::.......|.|:||:
  Fly    90 QAKMLDMLKQTGRPEMVVGWY 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 17/85 (20%)
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 17/86 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.