DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and psmd7

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_956083.1 Gene:psmd7 / 327330 ZFINID:ZDB-GENE-030131-5541 Length:327 Species:Danio rerio


Alignment Length:272 Identity:64/272 - (23%)
Similarity:125/272 - (45%) Gaps:21/272 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KVYLKPLVFFQIIDAYDRRPKGDNQ--VMGTLLGRNKEGHIEITNCFTVPHKEHSENKRI-DLDM 72
            :|.:.|||...::|.::|..|..:|  |:|.|||..::..::::|.|.||..|..::..: .||.
Zfish     8 RVVVHPLVLLSVVDHFNRIGKVGSQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDH 72

  Fly    73 AYASEVLELNMFAYPN--ERVLGWFCTGKSVSRSASLIHDYYVRECCEGQPLHLLVDAALKNQRL 135
            .|...:  ..||...|  ||::||:.||..:.::...|:: .:::.|....| :::|...|:..|
Zfish    73 DYLENM--YGMFKKVNARERIVGWYHTGPKLHKNDIAINE-LMKQYCSNSVL-VIIDVKPKDLGL 133

  Fly   136 STRLYCAVEMGVPGGT-KGLMFSLVPLEISNENSDLVA----LRCIEKQSQQQASKQMERFVPEL 195
            .|..|.:||.....|| ....|..|..||..|.::.|.    ||.|:..:....|::       :
Zfish   134 PTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQR-------I 191

  Fly   196 AQVVDATRDMQHRLDLVLRYINDVLARKKKPDNVVGRSLYAALTAVPLLDSDKFRVMFNTNLRDM 260
            ...|...:.:..:|..:..|:..|...|...::.:...|......:|.::..:|...|.....|.
Zfish   192 TNQVHGLKGLNSKLLDIKSYLEKVATGKLPINHQIIYQLQDVFNLLPDVNLQEFVKAFYLKTNDQ 256

  Fly   261 LMAITLSTMIKT 272
            ::.:.|:::|::
Zfish   257 MLVVYLASLIRS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 64/271 (24%)
psmd7NP_956083.1 PLN03246 6..290 CDD:215645 64/272 (24%)
MPN_RPN7_8 7..287 CDD:163693 64/272 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D455272at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.