DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and Cops6

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001100599.1 Gene:Cops6 / 304343 RGDID:1309919 Length:344 Species:Rattus norvegicus


Alignment Length:280 Identity:66/280 - (23%)
Similarity:123/280 - (43%) Gaps:19/280 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMSRNFSMRAKVYLKPLVFFQIIDAYDR------RPKGDNQVMGTLLGRNKEGHIEITNCFTVPH 59
            :|:...:....|.|.|||...|.|.:.|      ||.   ||:|.|:|:.:..:||:.|.|.:  
  Rat    47 VMASGVTGSVSVALHPLVILNISDHWIRMRSQEGRPM---QVIGALIGKQEGRNIEVMNSFEL-- 106

  Fly    60 KEHSENKRIDLDMAYASEVLELNMFAYPNERVLGWFCTGKSVSRSASLIHDYYVRECCE--GQPL 122
            ..|:..|:|.:|..|.....|.....:.....|||:.||.....|...:|    ::.||  ..||
  Rat   107 LSHTVEKKIIIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVH----KQVCEIIESPL 167

  Fly   123 HLLVDAALKNQRLSTRLYCAVEMGVPGGTKGLMFSLVPLEISNENSDLVALRCIEKQSQQQASKQ 187
            .|.::...|:..|...::.:| :.:..|...::|:.:...::.|.::.:.:..:.:.: ...|.:
  Rat   168 FLKLNPMTKHTDLPVSVFESV-IDIINGEATMLFAELTYTLATEEAERIGVDHVARMT-ATGSGE 230

  Fly   188 MERFVPELAQVVDATRDMQHRLDLVLRYINDVLARKKKPDNVVGRSLYAALTAVPLLDSDKFRVM 252
            .......|.....|.:.:..|:.|:|.|:....|.:...::.:.|..||....:|:|.:|||:..
  Rat   231 NSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTD 295

  Fly   253 FNTNLRDMLMAITLSTMIKT 272
            |.....|:.:...|.|:.||
  Rat   296 FYDQCNDVGLMAYLGTITKT 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 65/269 (24%)
Cops6NP_001100599.1 MPN_CSN6 56..338 CDD:163694 65/271 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.