DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and Mysm1

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_008762133.1 Gene:Mysm1 / 298247 RGDID:1311787 Length:811 Species:Rattus norvegicus


Alignment Length:212 Identity:46/212 - (21%)
Similarity:78/212 - (36%) Gaps:55/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QVMGTLLGRNKEGHIEITNCFTVPHKEHSENKRIDLD---MAYASEVLELNMFAYPNERVLGWFC 96
            :|:|.|.||..|....:..|...|....|...:.::|   ...|||.|.|...:     |:||:.
  Rat   580 EVIGLLGGRYSEADKVLEVCAAEPCNSLSTGLQCEMDPVSQTQASETLALRGCS-----VIGWYH 639

  Fly    97 TGKSVSRSASL--------IHDYYVRECCEGQPLHLLVDAALKNQRLS-TRLYCAV--EMGVPGG 150
            :..:...:.||        ...|:.|.  ..:.:.::|....::..|. :::.|.|  |...|.|
  Rat   640 SHPAFDPNPSLRDIDTQAKYQSYFSRG--GAKFIGMIVSPYNRSNPLPYSQITCLVISEELSPDG 702

  Fly   151 TKGLMF-------------------------------SLVPLE-ISNENSDLVALRCIEKQSQQQ 183
            |..|.:                               |.||:: |...:|||..|:.:.:..::.
  Rat   703 TYRLPYKFEVQQMLEEPQWELVFEKTRWIIEKYRLSHSSVPMDRIFRRDSDLTCLQKLLECLRKT 767

  Fly   184 ASKQMERFVPE--LAQV 198
            .||....|:.|  |.||
  Rat   768 LSKVANCFIAEEFLTQV 784

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 46/212 (22%)
Mysm1XP_008762133.1 Myb_DNA-binding 116..160 CDD:395191
SWIRM 365..444 CDD:398234
MPN_2A_DUB 554..736 CDD:163698 31/162 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.