DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and Eif3f

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001264231.1 Gene:Eif3f / 293427 RGDID:1306112 Length:361 Species:Rattus norvegicus


Alignment Length:277 Identity:103/277 - (37%)
Similarity:162/277 - (58%) Gaps:22/277 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VYLKPLVFFQIIDAYDRRPKGDNQVMGTLLGRNKEGHIEITNCFTVPHKEHSENKRIDLDMAYAS 76
            |.|.|::...|:|:|:||.:|..:|:|||||...:..:|:||||:|||.| ||:: :.:||.:|.
  Rat    96 VRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNE-SEDE-VAVDMEFAK 158

  Fly    77 EVLELNMFAYPNERVLGWFCTGKSVSRSASLIHDYYVRECCEGQPLHLLVDAALKNQRLSTRLYC 141
            .:.||:....|||.:|||:.||..::..:.|||:||.||.  ..|:||.||..|:|.|:|.:.|.
  Rat   159 NMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREA--PNPIHLTVDTGLQNGRMSIKAYV 221

  Fly   142 AVEMGVPGGTKGLMFSLVPLEISNENSDLVALRCIEKQSQQQASKQMERFVP--------ELAQV 198
            :..|||||.|.|:||:.:.::.:..:::.:.:..|.|..          |.|        :|.||
  Rat   222 STLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTC----------FSPNRVIGLSSDLQQV 276

  Fly   199 VDATRDMQHRLDLVLRYINDVLARKKKPDNVVGRSLYAALTAVPLLDSDKFRVMFNTNLRDMLMA 263
            ..|:..:|..|..||:|..|||:.|...||.|||.|.:.:..||.:..|.|..|.|:|:.|:||.
  Rat   277 GGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMV 341

  Fly   264 ITLSTMIKTQLEISEKL 280
            ..|:.:.::|:.::|||
  Rat   342 TYLANLTQSQIALNEKL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 101/275 (37%)
Eif3fNP_001264231.1 MPN_eIF3f 96..358 CDD:163695 101/275 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340983
Domainoid 1 1.000 82 1.000 Domainoid score I8219
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54712
OrthoDB 1 1.010 - - D1038775at2759
OrthoFinder 1 1.000 - - FOG0004972
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10540
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3506
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.820

Return to query results.
Submit another query.