DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and Brcc3

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001159929.1 Gene:Brcc3 / 210766 MGIID:2389572 Length:291 Species:Mus musculus


Alignment Length:307 Identity:62/307 - (20%)
Similarity:109/307 - (35%) Gaps:105/307 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QVMGTLLG----------------------RNKEGHIEITNCFTVPHKEHSENK--RIDLD---- 71
            :|||..:|                      :.|...|.|.:..:|.....|:.:  |:::.    
Mouse    33 EVMGLCIGELNDDIRSDSKFTYTGTEMRTVQEKMDTIRIVHIHSVIILRRSDKRKDRVEISPEQL 97

  Fly    72 MAYASEVLELNMFAYPNERVLGWFCTGKSVSRSASLIHDYYVRECCEGQPLHLLVDAALKNQRLS 136
            .|.::|...|........||:||:.:...::...|.:.   ||.    |.::.::|.        
Mouse    98 SAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVD---VRT----QAMYQMMDQ-------- 147

  Fly   137 TRLYCAVEMGVPGGTKGLMFSLVPLEISNENSDLVALRCIEKQSQQQASKQMER------FVP-- 193
                         |..||:||.. :|..|..:..|...|.: ..|.|.|.:.||      .||  
Mouse   148 -------------GFVGLIFSCF-IEDKNTKTGRVLYTCFQ-SIQAQKSSEYERIEIPIHIVPHI 197

  Fly   194 -----------ELAQVV-----DATR---DMQHRLDLVLRYINDVLARKKKPDNVVGRSLYAALT 239
                       ||.:::     ||.|   .:.| ||.|.:..|         .:|..::|.:.::
Mouse   198 TIGKVCLESAVELPKILCQEEQDAYRRIHSLTH-LDSVTKIHN---------GSVFTKNLCSQMS 252

  Fly   240 AV--PLLDSDKFRVMFNTNLRDMLMAITLSTMIKTQLEISEKLSCMQ 284
            ||  |||...:.|:..|..        .|..:.:.:.|:.|:||.::
Mouse   253 AVSGPLLQWLEDRLEQNQQ--------HLQELQQEKEELMEELSSLE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 60/301 (20%)
Brcc3NP_001159929.1 MPN_BRCC36 13..267 CDD:163699 56/273 (21%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 122..135 1/12 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.