DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and Stambp

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_612540.1 Gene:Stambp / 171565 RGDID:619963 Length:424 Species:Rattus norvegicus


Alignment Length:151 Identity:32/151 - (21%)
Similarity:61/151 - (40%) Gaps:33/151 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 DAALKNQ---RLSTRLYCAVEMG--VP------GGTKGLMFSLVPLEISNENSDLVALR-----C 175
            |.:|..|   |:.::|..|||:.  :|      .|.:.:..:.:..|..|.....:...     .
  Rat     6 DVSLPPQDRVRILSQLGSAVELNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLF 70

  Fly   176 IEKQSQQQASKQMERFVPELAQVVDATRDM------QHRLDLVLRYIND---VLARKKKPDNVVG 231
            |||..:.:..|  ...:||....|...:::      :.:.:|:.||..:   ...||||.:..:.
  Rat    71 IEKLPKHRDYK--SAIIPEKKDAVKKLKNVAFPKAEELKTELLKRYTKEYEQYKERKKKEEEELA 133

  Fly   232 RSLYAALTAVPL-LDSDKFRV 251
            |::     |:.. |:.:|.||
  Rat   134 RNI-----AIQQELEKEKQRV 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 32/151 (21%)
StambpNP_612540.1 Interaction with CHMP3. /evidence=ECO:0000250 1..127 24/122 (20%)
USP8_dimer 8..115 CDD:401063 20/108 (19%)
Interaction with STAM1. /evidence=ECO:0000250 227..231
MPN_AMSH_like 254..424 CDD:163697
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 335..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.