DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and Rpn11

DIOPT Version :10

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_314713.2 Gene:Rpn11 / 1275466 VectorBaseID:AGAMI1_002186 Length:311 Species:Anopheles gambiae


Alignment Length:86 Identity:17/86 - (19%)
Similarity:41/86 - (47%) Gaps:4/86 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KVYLKPLVFFQIIDAYDRRPKGDNQVMGTLLGRNKEGH-IEITNCFTVPHKEHSENKRIDLDMAY 74
            :||:..|...:::.  ..|.....:|||.:||...:.: :::.:.|.:|......:... :|..:
Mosquito    31 QVYISSLALLKMLK--HGRAGVPMEVMGLMLGEFVDDYTVQVIDVFAMPQTGTGVSVEA-VDPVF 92

  Fly    75 ASEVLELNMFAYPNERVLGWF 95
            .:::|::.......|.|:||:
Mosquito    93 QAKMLDMLKQTGRPEMVVGWY 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 17/85 (20%)
Rpn11XP_314713.2 MPN_RPN11_CSN5 22..287 CDD:163700 17/86 (20%)

Return to query results.
Submit another query.