DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and LOC1270454

DIOPT Version :10

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_061500536.1 Gene:LOC1270454 / 1270454 VectorBaseID:AGAMI1_007503 Length:426 Species:Anopheles gambiae


Alignment Length:112 Identity:19/112 - (16%)
Similarity:43/112 - (38%) Gaps:17/112 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PNERVLGWFCTGKSVSRSASLIHDYYVRECCEGQPLHLLVDAALKNQRLSTRLYCAVEMGVPGGT 151
            |::|:.......:.||...::..:.|.|   .|..:....|.:|:...|....           |
Mosquito    18 PHQRLQKLVADSQRVSIDPTMPINRYYR---SGNQIVETADRSLREGNLEKAF-----------T 68

  Fly   152 KGLMFSLVPLEISNENSDLVALRCIEKQSQQQASKQMERFVPELAQV 198
            ..|.|..:.:|:..|:.   ..|.:....:||..:::::.:|...::
Mosquito    69 FYLRFVTIFVELILEHP---GYRSVPPADKQQTKEKIKKIMPRAEEI 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 19/112 (17%)
LOC1270454XP_061500536.1 None

Return to query results.
Submit another query.